KEGG   Amycolatopsis mediterranei S699: RAM_31120Help
Entry
RAM_31120         CDS       T01822                                 

Definition
(GenBank) beta-N-acetylhexosaminidase
  KO
K12373  hexosaminidase [EC:3.2.1.52]
Organism
amn  Amycolatopsis mediterranei S699
Pathway
amn00511  Other glycan degradation
amn00520  Amino sugar and nucleotide sugar metabolism
amn01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:amn00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    RAM_31120
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    RAM_31120
Enzymes [BR:amn01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     RAM_31120
Chaperones and folding catalysts [BR:amn03110]
 Intramolecular chaperones
  Others
   RAM_31120
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_20 Glyco_hydro_20b
Motif
Other DBs
NCBI-ProteinID: AEK44699
UniProt: G0G0G4
Position
6723791..6725158
Genome map
AA seq 455 aa AA seqDB search
MAFDTLLPRPVSVTPAPGSCPCPSTVDVRTGALPAEGYRLTVSPAGVVLEAADFAGECHG
RETLRQLAGPSAFRVAGFAPSSLPCGVVEDHPRFGWRGCLLDVARHFRTKAEVLRFVDLL
AAHKLNVLNLHLTDDQGWRFEVPAFPRLTSVGGWRPSSMAGSGGVQDGRPHGGFYTGDDL
REIVAYAASRAITVVPEIDIPGHARAALAAYPALGTASSYEVWTAWGISTSLLSPSPSAL
DFFRQVFDHLLDIFPSKVIALGGDETPGATDEHRAFVRQLAEYLVARGRTPMGWDEVLDI
DGLPPMVIGAWRNEDAGLRAASAGHDVVLCPEQHVYLDHRQSDHPDEPIPVGEVHTLEDV
YAYEPALSGPRLRGVQAQVWSEHLDSVRRVDYMAFPRLSAFAEVAWSTGPREYAEFLPRL
RDHHLPRLDALGVEYRPLDGPHPWQTRPGVPGRPR
NT seq 1368 nt NT seq  +upstreamnt  +downstreamnt
atggctttcgacaccctgctcccccgcccggtttcggtgacgcccgcgccgggttcgtgc
ccctgtccgtccactgtggacgtccggaccggcgccctgccggcggagggctatcggctc
accgtttccccggccggcgtggtcctggaggcggccgatttcgccggggagtgtcacggc
cgggagacgctgcggcagctcgcggggccgtccgcgttccgggtggccgggttcgcacct
tcgtccctgccgtgcggcgtggtcgaggaccacccgcggttcggctggcgcgggtgtctg
ctcgacgtggcccggcacttccggaccaaggccgaggtgctccggttcgtcgacctgctg
gccgcgcacaagctgaacgtgctgaacctgcacctcaccgacgaccagggctggcgcttc
gaggtccccgcgttcccccggctgacgtcggtgggcggctggcggccgtcgtcgatggcc
ggcagcggaggtgtgcaggacgggcgtccgcacggcgggttctacaccggcgacgacctg
cgcgagatcgtcgcctacgccgcttcgcgggccatcacggtggtgccggagatcgacatc
ccgggccacgcgcgggcggccttggcggcctaccccgcgctggggacagcgtcgtcctac
gaagtctggaccgcctggggcatcagcacttcgctgctgtcaccgtctccgtctgctttg
gacttcttccgccaggtgttcgaccacctgctggacatcttcccgtcgaaggtgatcgcc
ttgggcggcgacgagacgccgggcgcgaccgacgagcaccgcgcgttcgtgcgacagctg
gcggagtacctggtggcccgcggccgcaccccgatgggctgggacgaagtcctcgacatc
gacggcctcccgccgatggtgatcggtgcgtggcgcaacgaagacgcgggcctgcgggcg
gcttcggcggggcacgacgtggtgctgtgcccggagcagcacgtgtacctggaccaccgg
cagtccgaccatcccgacgagccgatcccggtcggggaggtgcacacgctggaggacgtc
tacgcgtacgagccggcgctgagcggcccgcggttgcggggggtgcaggcgcaggtgtgg
agcgaacacctggacagcgtccggcgggtggactacatggcgttcccgcggttgtcggcg
ttcgcggaggtggcgtggagcacggggccgcgggagtacgcggagttcctgccgcggctg
cgggaccaccacctgccccgcctggacgcgctcggcgtggagtaccggccgctggacggg
ccgcacccctggcagacgcggccgggggtgccgggccggccgcgctga

DBGET integrated database retrieval system