KEGG   Amycolatopsis mediterranei S699: RAM_34305Help
Entry
RAM_34305         CDS       T01822                                 

Definition
threonine synthase (EC:4.2.3.1)
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
amn  Amycolatopsis mediterranei S699
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:amn00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    RAM_34305
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    RAM_34305
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    RAM_34305
Enzymes [BR:amn01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     RAM_34305
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
7365407..7366672
Genome map
AA seq 421 aa AA seqDB search
MTATLGTTSTTKTPDLGPAVELVSKEEGHRQPLAPEFVSAEDFSPLEVAYDFGRVRREDI
EAGPKNIWRYKKLLPVPSNVEEIPNTEPGATRLVRADRLAKELGLKRVWVKDDTGNPTHS
FKDRVVAVALAAAREFGFEVLACPSTGNLANATAAAAARAGWRSVVLIPKSLERAKILTT
AVYDGDLIAIDGNYDDVNRLATELAGEHPKWAFVNVNVRPYYSEGSKTLAFEVAEQLGWR
IPPQIVVPIASGSQLTKVDKGFRELGQLGLVDASPYKVFGAQATGCSPVSAAFRAGQDVV
QPVKPDTIARSLAIGNPADGPYVLDIVNRTGGAIEDVSDEEVVEGIRLLARTEGIFTETA
GGVTVATAKKLVETGKLDPDAETVLLITGDGLKTLDAIENHVGPKATLPPSAAAVNKALG
Y
NT seq 1266 nt NT seq  +upstreamnt  +downstreamnt
atgaccgccaccctcggcacgacctccaccaccaagaccccggatctcggacccgccgtc
gagctggtgtcgaaggaagagggccaccggcagccgctcgctccggagttcgtctccgcc
gaagacttctcaccgctcgaggtcgcctacgacttcggccgcgtccgccgcgaagacatc
gaagccggccccaagaacatctggcgctacaagaaactccttcccgttccgtccaacgtc
gaagagatcccgaacaccgagccgggcgcgacgcgcctggtccgcgccgaccgcctcgcc
aaggaactcggcctcaagcgcgtgtgggtcaaggacgacaccggcaacccgacgcactcg
ttcaaggaccgcgtcgtcgccgtcgcgctggccgcggcccgcgagttcggtttcgaggtg
ctcgcgtgtccctcgaccggcaacctggccaacgcgacggccgccgccgcggcccgcgcc
ggctggcggtcggtcgtgctgatccccaagtctctcgagcgcgccaagatcctcaccacc
gcggtgtacgacggcgacctcatcgccatcgacggtaactacgacgacgtcaaccgcctc
gccaccgagctcgccggcgagcacccgaagtgggcgttcgtcaacgtgaacgtccggccg
tactactcggagggctcgaagacgctggccttcgaggtcgccgagcagctcggctggcgc
atcccgccgcagatcgtcgtgccgatcgcctccggttcgcagctgaccaaggtggacaag
ggtttccgtgagctggggcagctcggtctcgtggacgccagcccgtacaaggtgttcggc
gcgcaggccaccggctgctcgccggtgtcggccgcgttccgcgccggccaggacgtggtc
cagccggtgaagccggacacgatcgcccgctcgctggcgatcggcaacccggccgacggc
ccgtacgtgctcgacatcgtcaaccgcaccggcggcgcgatcgaggacgtctccgacgaa
gaggtcgtcgagggcatccgcctgctggcccgcaccgaaggcatcttcaccgagacggcc
ggcggggtcaccgtcgccacggcaaagaagctggtcgagacgggcaagctggacccggac
gccgagaccgtgctgctcatcaccggcgacggcctcaagaccctcgacgcgatcgagaac
cacgtcggccccaaggcgaccctgccgccctcggccgcagccgtgaacaaggccctcggc
tactga

DBGET integrated database retrieval system