KEGG   Amycolatopsis mediterranei S699: RAM_35910Help
Entry
RAM_35910         CDS       T01822                                 

Definition
(GenBank) tryptophan synthase subunit beta
  KO
K06001  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
amn  Amycolatopsis mediterranei S699
Pathway
amn00260  Glycine, serine and threonine metabolism
amn00400  Phenylalanine, tyrosine and tryptophan biosynthesis
amn01100  Metabolic pathways
amn01110  Biosynthesis of secondary metabolites
amn01130  Biosynthesis of antibiotics
amn01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:amn00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    RAM_35910
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    RAM_35910
Enzymes [BR:amn01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     RAM_35910
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP NAD_Gly3P_dh_N
Motif
Other DBs
NCBI-ProteinID: AEK45655
UniProt: G0G4Z8
Position
complement(7737702..7739054)
Genome map
AA seq 450 aa AA seqDB search
MAEQTKYVLDEADLPAQWYNVIPDLPEPPPPPLHPGTREPVGPDDLAPLFPQALIAQEVT
TDRYVDIPDEVREVYRLWRPSPLFRARRLEKALGTPARIYYKYEGVSPVGSHKPNTAVPQ
AFYNAAEGVRRLTTETGAGQWGSALAFACAQYGLECEVWQVRASYDQKPYRKLMMETFGA
TVHPSPSELTESGRAILKQHPDSTGSLGIAISEAVEQAAQDPDTRYALGSVLNHVLLHQT
VIGEEALKQFELAGDTPDLLVGCTGGGSNFGGLAFPFLREKLAGRMDPVIRAVEPAACPS
LTRGKYAYDFGDTAGLTPLLKMHTLGHEFIPDPIHAGGLRYHGMSPLISHIHELGLIEAI
AIGQQECFAAGVRFARSEGIIPAPEPTHALAACIREALRCKETGEEKVILTALCGHAHLD
LPAYGAYLAGDMVDDELSDATLEESLAALP
NT seq 1353 nt NT seq  +upstreamnt  +downstreamnt
atggctgagcagaccaaatacgtcctggacgaagccgatctccccgcccagtggtacaac
gtcatccccgacctgcccgagccgccgccaccgccgctgcaccccggcacgcgcgagccc
gtcggcccggacgacctcgcgccgctgttcccgcaggcgctcatcgcccaggaagtgacg
acggatcgctatgtcgacatcccggacgaagtgcgggaagtctaccggctctggcgcccg
tcgccgctgttccgggcgcgacggctggagaaggcgctgggcacccccgcgcggatctac
tacaagtacgaaggcgtcagcccggtcggctcccacaagccgaacaccgccgtgccgcag
gcgttctacaacgcggccgaaggcgtccggcggctgaccaccgagaccggcgccggccag
tgggggagcgcactcgctttcgcctgcgcccagtacgggctggagtgcgaggtctggcag
gtgcgcgcgtcctacgaccagaagccctaccgcaagctgatgatggagacgttcggcgcg
accgtccacccgagcccgtcggagctgaccgagtcgggccgggcgatcctcaagcagcac
ccggactcgacgggcagtctcggcatcgcgatcagcgaggccgtcgagcaggcggcgcag
gacccggacacgcggtacgcgctcggcagcgtgctcaaccacgtgctgctgcaccagacg
gtcatcggtgaggaagcgctgaagcagttcgagctggccggcgacaccccggacctcctg
gtcggctgcaccggcggcggctccaacttcggcgggctcgctttcccgttcctgcgcgag
aaactggccggccggatggacccggtgatccgcgcggtcgagccggcggcgtgcccgtcg
ctgacgcgcggcaagtacgcctacgacttcggcgacaccgccgggctgacaccgctgctg
aagatgcacacgctcggccacgagttcatcccggacccgatccacgcgggcggtttgcgc
taccacgggatgtccccgctgatttcgcacatccacgagctcggcctgatcgaggcgatc
gcgatcggccagcaggagtgtttcgcggcgggggtgcggttcgcccggtccgagggcatc
atcccggcgccggagccgacccacgcgctcgcggcgtgcatccgggaagcgttgcggtgc
aaggaaaccggcgaggagaaggtgatcctgacggcgctgtgcggtcacgcccacctcgac
ctgccggcgtacggtgcttacctcgccggggacatggtggacgacgagctttccgatgcg
acgcttgaggagtctctggccgccttgccctga

DBGET integrated database retrieval system