KEGG   Amycolatopsis mediterranei S699: RAM_36195Help
Entry
RAM_36195         CDS       T01822                                 

Definition
(GenBank) magnesium chelatase subunit ChlD
  KO
K03404  magnesium chelatase subunit D [EC:6.6.1.1]
Organism
amn  Amycolatopsis mediterranei S699
Pathway
amn00860  Porphyrin and chlorophyll metabolism
amn01100  Metabolic pathways
amn01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:amn00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    RAM_36195
Enzymes [BR:amn01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     RAM_36195
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: VWA_2 Mg_chelatase VWA AAA_5 MCM VWA_CoxE Sigma54_activat AAA_3 AAA_16
Motif
Other DBs
NCBI-ProteinID: AEK45712
UniProt: G0G555
Position
complement(7794164..7796104)
Genome map
AA seq 646 aa AA seqDB search
MKPYPFTAVVGLPDLRLALVLSSISPAVGGVLVRGEKGTAKSTMVRALAGLLPGVDVVDG
CRFSCDPAAPDPLCPDGPHDGANSHRRPAKLVELPVGAAEDRVIGSLHLERALAEGVTDF
QPGLLAAAHRGLLYVDEVNLLHDHLVDTLLDAAAMGRATVEREGVSVSHAARFVLIGTMN
PEEGELRPQLLDRFGLTVEVASSRDPEQRVEVVRRRLAYEADPDAFAAQYAGEDARLAAD
IEAAQRLLPAVKLPDEALRRIAEVCASFEVDGMRADIVTARAAVAHAAWAGRDEVTTEDV
RVAARLALPHRRRRNPFDAPGISEEQLEQALQDAEPDPGPEDDGPGSGSAPSQDEAPQGK
APQGEPKQQNGGQQKTVGAGDTFKARVFRVKGMGEGERGRRSRAITDSGRTIGVQPASVR
EGRPHLVATVKAAAPHQKARGRTGAGLELRPEDLRFALREGREGNLVLFCVDASGSMGAK
ARMREVKSAVLSLLLDAYQRRDKVGLVTFRGDAAELALPPTISVDAAASRLEGLPTGGRT
PLAEGLLEAARVLRVEEIRDPRRRPLLVVVTDGRATSGPDAVARAKAAAGLLAGVTTILM
DCESGKMRLGLAADLAAHLGAEHVPLADVAAESLADAVRARTGRAA
NT seq 1941 nt NT seq  +upstreamnt  +downstreamnt
ttgaagccgtacccgttcaccgccgtagtcgggctgccggacctgcgcctggcgctggtc
ctgtcctcgatctcgcccgccgtcggcggggtgctggtgcgcggcgaaaagggcacggcg
aagtcgaccatggtccgcgcgctcgccggcctgctgccgggtgtcgacgtcgtcgacggc
tgccggttctcctgcgatcccgcggctcccgacccgctctgcccggacggcccgcacgac
ggcgcgaacagccaccggcggcccgcgaagctggtcgaactcccggtcggcgccgccgaa
gaccgcgtcatcggctcgctgcacctcgaacgcgcgctcgccgaaggcgtcacggacttc
cagcccggcttgctggccgccgcgcaccgcgggctgctctacgtcgacgaggtcaacctg
ctgcacgaccacctcgtcgacacgctcctggacgccgcggcgatgggccgcgcgaccgtg
gaacgcgaaggcgtttcggtctcgcacgccgcgcggttcgtgctgatcggcaccatgaac
cccgaagagggcgagctccggccgcagctgctggaccggttcgggctgaccgtcgaggtc
gcctccagccgcgatccggagcagcgcgtcgaggtcgtccgccgtcgcctggcctacgaa
gccgatcccgacgccttcgccgcgcagtacgccggcgaagacgcccggctcgccgcggac
atcgaagcggcacaacggcttctgcccgcggtcaagctccccgacgaggccctgcgccgg
atcgccgaggtctgcgcgtccttcgaggtcgacggcatgcgcgcggacatcgtcacggca
cgggcggcggtcgcgcacgcggcctgggccggccgcgacgaggtgaccaccgaggacgtc
cgcgtcgccgcgcggctcgcgctgccgcaccggcgccgccggaacccgttcgacgcaccg
gggatctcggaagagcagctggagcaggcgttgcaggacgccgaaccggacccggggccc
gaggacgacggccccggctcgggctcggcgccgtctcaagacgaagccccgcagggcaag
gcacctcaaggcgaaccgaagcagcagaatggcggtcagcagaagaccgtcggcgccggc
gacacgttcaaggcacgcgtcttccgcgtcaaaggaatgggcgagggtgaacgcggacgc
cgttcgcgcgcgatcaccgacagcggccggacgatcggcgtccagcccgcgagcgtccgc
gaaggccggccgcacctggtcgcgaccgtgaaagccgcggcaccgcaccagaaagcccgc
ggccgcaccggcgccgggctcgaactgcgtccggaagacctgcggttcgcgctgcgcgaa
ggccgcgaaggcaacctcgtgctgttctgcgtggacgcgtccggttcgatgggcgcgaag
gcgcggatgcgcgaggtcaagtccgcggtcctgtcgctgctgctcgacgcctaccagcgc
cgcgacaaggtcgggctcgtcacgttccgcggcgacgcggccgaactcgcgctgccgccg
acgatcagcgtcgacgcggccgcgtcccgcctcgaaggcctcccgaccggcggccggacg
cccctggccgaagggctcctggaggcggcgcgcgtgctgcgtgtcgaggagatccgcgac
ccccggcgccgtccgctgctggtcgtcgtcaccgacggccgcgccaccagcggtcccgac
gccgtcgcccgcgccaaggccgcggccgggctcctggccggcgtcacgacgatcctcatg
gactgcgagagcggcaagatgcgcctcggcctggccgccgacctcgccgcccacctcggc
gcggaacacgtccccctcgccgacgtcgccgccgaatcgctggcggacgccgtccgcgcc
cggaccggaagggccgcctga

DBGET integrated database retrieval system