KEGG   Amycolatopsis mediterranei S699: RAM_37970Help
Entry
RAM_37970         CDS       T01822                                 

Definition
alpha-galactosidase
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
amn  Amycolatopsis mediterranei S699
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:amn00052]
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:amn00561]
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:amn00600]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
8160548..8162176
Genome map
AA seq 542 aa AA seqDB search
MPARTRSRVLHLFTAAAAAVALSAAVPPAAVAAPGSPAVTPPLGWNSWNSFGCNVSESTI
HQAADAMVSSGMRDAGYQYVVVDDCWFDPQRDAQGNLRGNASKFPGGMKALGDYIHARGL
KFGIYQVPTDRTCAQRGGAYPGSTGSQGHETQDARTFASWGVDYLKYDWCSPAGTRDEQV
SRFGLMRDALRGTGRPIVYSINPNSYHAITGDKYDWGQVADLWRTTEDLLDIWQNGNTNS
YPMGVGNVLDVTAPLAAQAGPGHWNDPDMLVVGRPGLSLTESRAHFTLWALMAAPLMAGN
DIRTMSADISAVLRNPRLLAVDQDRLGAGGRRVRDDGDVEVFAKPLADGSVAVGLLNRGG
TTTAISTTAAQIGLSGTSFTLTDLWTGGTSASSGAISASVPAHGAAAYRVSGGTPLAATT
SRLRGAGANRCLDVDNASTASGAGTLIWDCQTAANQLWTTWANGEIRVFGDKCLDATTSG
ARVFSRTCTGQSNQQWTLGSDGTIRNVQSGLCLDVEGAATANGTHAILWTCNGQANQRWS
RV
NT seq 1629 nt NT seq  +upstreamnt  +downstreamnt
atgcccgctcgaacccgttcacgggtcctgcacctgttcaccgcggcggccgccgcggtg
gcgttgtccgcagcggttccgccggccgccgtcgccgcgcccgggagcccggcggtgacc
ccgccactgggctggaacagctggaacagcttcggctgcaacgtcagcgagtccaccatc
caccaggctgccgacgcgatggtctcctcgggcatgcgtgacgccggctaccagtacgtc
gtcgtcgacgactgctggttcgacccgcagcgcgacgcccagggcaacctgcgcggcaac
gcctcgaagttccccggcggcatgaaggccctcggcgactacatccacgcccgcggcctg
aagttcggcatctaccaggtccccaccgaccgcacgtgcgcccagcgcggcggcgcctac
cccggctccaccggcagccagggccacgaaacccaggacgcccgcacgttcgcttcctgg
ggcgtcgactacctcaagtacgactggtgctcccccgccggcacccgcgacgaacaggtc
agccgcttcggcctgatgcgcgacgccctgcgcggcaccggccggcccatcgtgtacagc
atcaaccccaacagctaccacgccatcaccggcgacaagtacgactggggccaggtcgcc
gacctgtggcgcaccaccgaagacctgctcgacatctggcagaacgggaacaccaacagc
tacccgatgggcgtcggcaacgtcctcgacgtcaccgccccgctggccgcccaggccggt
cccgggcactggaacgaccccgacatgctcgtcgtcggccgccccggcctgtcgctgacc
gaatcccgcgcgcacttcaccctctgggccctgatggcggcgccgctcatggcgggcaac
gacatccgcaccatgtccgcggacatcagcgccgtcctgcgcaacccccgcctgctggcg
gtcgaccaggaccgcctcggcgccggcggccgccgggtccgcgacgacggcgacgtcgag
gtcttcgccaagccgctggccgacgggtccgtcgccgtcggcctgctcaaccgcggcggc
accaccaccgcgatcagcaccaccgcggcgcagatcgggctctccggcacttcgttcacc
ctgaccgacctgtggaccggcggcacgtcggcgagcagcggagcgatcagcgcgagcgtg
ccggcccacggcgccgccgcctaccgcgtctccggcggcaccccgctcgccgccacgacg
tcgcggctgcgcggcgccggcgccaaccgctgcctcgacgtcgacaacgcctccaccgcg
tccggcgcgggcacgctgatctgggactgccagaccgccgccaaccagctgtggaccacc
tgggcgaacggcgagatccgcgtcttcggcgacaagtgcctcgacgccacgaccagcgga
gcccgcgtcttcagccggacgtgcaccgggcagagcaaccagcagtggacgctcggctcg
gacggcacgatccgcaacgtccaatcaggactgtgcctcgacgtcgaaggcgccgcgacg
gccaacgggacccacgcgatcctgtggacctgcaacggccaggcgaaccagcggtggagc
cgcgtctga

DBGET integrated database retrieval system