KEGG   Amycolatopsis mediterranei S699: RAM_38570Help
Entry
RAM_38570         CDS       T01822                                 

Definition
cholesterol oxidase
Orthology
K03333  
cholesterol oxidase [EC:1.1.3.6]
Organism
amn  Amycolatopsis mediterranei S699
Pathway
Steroid degradation
Brite
KEGG Orthology (KO) [BR:amn00001]
 Metabolism
  Xenobiotics biodegradation and metabolism
   00984 Steroid degradation
    RAM_38570
Enzymes [BR:amn01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.3  With oxygen as acceptor
    1.1.3.6  cholesterol oxidase
     RAM_38570
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(8292313..8293884)
Genome map
AA seq 523 aa AA seqDB search
MASAALAGRATAASSQPAVAGSAAAISDGARVTALVIGTGYGGSVAALRLAQAGVDVQMV
EMGMAWDTPGADGKIFCTTPNPDQRSFWLRTRTKQPLSNFLGFPIDKDIPRYTGILDAEE
FSGITVYQGRGVGGGSLVNGGMAVTPKRENFGAILPTVDANEMYDVYYPRANAGLGVASV
RPAWFETTDWYQFARVGRKQAQRSGFPFVFVPDVYDWDYMEREAAGTATKSALAGEILFG
NNYGKKSLQKTYLPKIAATGRVTISPLHRVTQVVPASGGGYTVTIEQLTTDGAVSAIKTV
TAAKVFFAAGSVGTSKLLVKLKATGALPNLNGEVGKGWGDNGNVMVGRANQIWDPTGASQ
STIPCGGIDNWAAGGAFAEVAPLPTGIETWASFYLSITKNPNRAQFTWNPTTRAVDLNWQ
TAWKQPGIDMAKTIFDKINATEGTIYRTDLFGTYKTWGDHLTYHPLGGAVLGKATDNYGR
LAGHPGLYAIDGSLIPGNTSVNPFVTITALAERNIEKIIAQDF
NT seq 1572 nt NT seq  +upstreamnt  +downstreamnt
ttggcgagcgccgcgctggccggtcgggccacggcagcgtcgtcgcagccggctgtggcg
ggctcggcggccgcgatttccgacggcgcccgggtgaccgcgctggtgatcggcaccggg
tacggcggctcggtcgccgcgctgcggctggcccaggccggcgtcgacgtgcagatggtc
gaaatgggcatggcctgggacaccccgggcgccgacggcaagatcttctgcaccacgccc
aatccggaccagcggtcgttctggttgcgcaccaggacgaagcagccgttgtcgaacttc
ctcgggttcccgatcgacaaggacatcccgcgctacacgggcatcctcgacgccgaggag
ttcagcgggatcaccgtgtaccagggccgcggcgtcggcggtggctcgctcgtcaacggc
ggcatggccgtcacgccgaagcgggagaacttcggcgcgatcctgccgacggtcgacgcg
aacgagatgtacgacgtctactacccgcgggcgaacgccgggctcggggtcgccagtgtc
cgcccggcctggttcgagaccaccgactggtaccagttcgcccgtgtcggccggaaacag
gcccagcggtccggtttcccgttcgtgttcgtgccggacgtgtacgactgggactacatg
gaacgggaggcggcgggcaccgccacgaagtcggcgctggccggggaaatcctgttcggc
aacaactacggcaagaaatcgctgcagaagacctacctgccgaagatcgccgcgaccggc
cgggtcaccatctcgccgctgcaccgcgtgacgcaggtggtgccggcctccggcggcggc
tacaccgtgaccatcgagcagctcaccaccgacggcgcggtgtccgcgatcaaaaccgtc
acggcggccaaggtgttcttcgccgcgggcagcgtcggcacgagcaagctgctggtgaag
ctgaaggcgaccggcgcgctgccgaacctcaacggcgaagtcgggaagggctggggcgac
aacgggaacgtgatggtcgggcgcgccaaccagatctgggacccgaccggggcctcccaa
tcgaccatcccgtgcggcggtatcgacaactgggccgcgggcggcgcgttcgccgaggtc
gcgccgctgccgaccgggatcgagacgtgggcgtcgttctacctctcgatcacgaagaac
cccaaccgcgcgcagttcacctggaaccccacgacgcgcgcggtggacctgaactggcag
acggcgtggaagcagccgggcatcgacatggcgaagaccatcttcgacaagatcaacgcg
accgagggcacgatctaccggaccgacctcttcggcacgtacaagacctggggcgaccac
ctcacctaccacccgctcggaggcgcggtgctcggcaaggcgaccgacaactacggcagg
ctcgccggccacccgggcctgtacgcgatcgacggctcgctgatcccgggcaacaccagc
gtcaacccgttcgtcaccatcaccgcactggcggaacgcaacatcgagaagatcatcgcg
caggacttctga

DBGET integrated database retrieval system