KEGG   Amycolatopsis mediterranei S699: RAM_39235Help
Entry
RAM_39235         CDS       T01822                                 

Definition
dihydropteroate synthase
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
amn  Amycolatopsis mediterranei S699
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:amn00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(8428481..8429065)
Genome map
AA seq 194 aa AA seqDB search
MKTPDLVFRGRRLSSDRALVLAAVEEPAAAREAVADGADLVSFAGAGAESRVEWARETFP
GLVIGVDTADPSVAAACCEAGADLIVARADLAEVAVRYGAGYAAPSVPSVAGLPASGVVV
DVGVFRAPGPFGAVPVLAEVAGDGTPAGLARTAVAASAGVAIIRTKHVRQVRHVAEMAAS
IAGTRPPAKAVRWE
NT seq 585 nt NT seq  +upstreamnt  +downstreamnt
atgaagacccccgacctcgtcttccggggccgccggttgagcagtgaccgcgcgctggtg
ctggccgcggtcgaagagcccgccgcggcccgcgaagccgtcgccgacggcgccgatctc
gtgagtttcgccggagccggcgccgagtcccgggtcgagtgggcgcgggagaccttcccc
ggcctcgtcatcggggtcgacaccgccgacccgtcggtcgccgcggcctgctgcgaagcg
ggtgccgacctgatcgtcgcgcgggcggacctggccgaggtcgcggtccgctacggcgcg
ggttacgccgctccttcggtgccctcggtggccggtttgcccgcttcgggcgtcgtcgtg
gacgtcggggtgttccgggcgcctggcccgttcggggcggtgcccgtgctggccgaggtg
gccggggacggcacgccggccggcctggcgcggacggcggtcgcggcctcggccggggtg
gcgatcatccgcacgaagcacgtccgccaggtgcgccacgtggcggagatggcggcgagc
atcgcgggcacccgcccgccggcgaaggcggtccggtgggagtga

DBGET integrated database retrieval system