KEGG   Amycolatopsis mediterranei S699: RAM_39660Help
Entry
RAM_39660         CDS       T01822                                 

Definition
nicotinamidase
Orthology
K08281  
nicotinamidase/pyrazinamidase [EC:3.5.1.19 3.5.1.-]
Organism
amn  Amycolatopsis mediterranei S699
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Nicotinate and nicotinamide metabolism [PATH:amn00760]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
8504602..8505180
Genome map
AA seq 192 aa AA seqDB search
MGTALIVVDVQNDFCEGGSLGLPGGAAAAAGISKQAAEGGYSHVVATRDNHIDPGDHFSE
TPDFKDSWPVHCVAGTPGASFHPALDVVPIGEVFSKGEYSAAYSGFEGSARDGKSLEAWL
REHDVTDVDVVGIATDFCVRATALDAAKAGFGVRVLLDLTVGGSQPTVDATLEDFDKAGV
AYTGTAVVGPAA
NT seq 579 nt NT seq  +upstreamnt  +downstreamnt
atgggaaccgcgctgatcgtggtggacgtgcagaacgacttctgcgaagggggctcgctc
ggtctgccgggcggggccgccgcggccgccggcatctcgaagcaggccgcggaaggcggg
tacagccacgtcgtggccacccgggacaaccacatcgaccccggagaccacttcagcgag
acgccggacttcaaggacagctggccggtgcactgcgtcgccggcacgccgggcgcgtcg
ttccaccccgcgctcgacgtcgtcccgatcggcgaggtgttctccaagggcgagtacagc
gccgcgtactccggcttcgagggctcggcccgcgacgggaagtccctggaggcgtggctg
cgcgagcacgacgtgaccgacgtcgacgtcgtcggcatcgcgacggacttctgcgtccgc
gcgacggcactcgacgcggcgaaggcgggcttcggcgtgcgggtgctgctggacctgacc
gtcggcggctcgcagccgacggtcgacgcgacgctcgaagacttcgacaaggcgggcgtc
gcgtacaccggcaccgccgtcgtcggcccggccgcgtga

DBGET integrated database retrieval system