KEGG   Amycolatopsis mediterranei S699: RAM_39915Help
Entry
RAM_39915         CDS       T01822                                 

Definition
UDP-N-acetylglucosamine 1-carboxyvinyltransferase (EC:2.5.1.7)
Orthology
K00790  
UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
amn  Amycolatopsis mediterranei S699
Pathway
Amino sugar and nucleotide sugar metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:amn00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    RAM_39915
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    RAM_39915
Enzymes [BR:amn01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.7  UDP-N-acetylglucosamine 1-carboxyvinyltransferase
     RAM_39915
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(8545557..8546831)
Genome map
AA seq 424 aa AA seqDB search
MSEHFDVHGGARLVGEVDVVGAKNSVLKLMAAALLAEGTTTITNCPQILDVPLMGDVLRS
VGCEVVIEGDTATITTPAELSHRADSAAMGKLRASVCVLGPLVGRLKQAVVALPGGDAIG
SRPLDMHQNGLRKLGATSTIEHGCVVAKAETLVGAQIWLDFPSVGATENILMAAVLAEGT
TVIDNCAREPEIVDICTMLTEMGAKIEGAGTSTLTVHGVEQLHPTTHSVIGDRIVGATWA
FAASMTRGDITVRGVNPHHLDLVLNKLHQAGADVETFGDKGFRVVQPERPKAVDWVTLPY
PGFATDLQPFAVALSAVSEGTSMITENVYEARFRFIEEMVRLSGDARTDGHHAVVRGVER
LSSAPVWASDIRAGAGLVLAGLCADGVTEVWDVFHIDRGYPHFVENLNRLGANIKRVAGE
PERK
NT seq 1275 nt NT seq  +upstreamnt  +downstreamnt
atgagcgagcacttcgacgtgcatggcggagcccggctggtcggcgaggtcgacgtggtc
ggcgccaagaacagcgtgctgaagctgatggccgccgccctcctcgcggaggggaccacg
accatcacgaactgcccgcagatcctcgacgtcccgctgatgggcgacgtgctgcggagc
gtcggctgcgaggtcgtcatcgagggcgacaccgccaccatcacgacgccggccgagctg
tcgcaccgcgcggactcggcggcgatgggcaagctgcgcgcgtccgtctgcgtgctgggg
ccgctggtcggccggctgaagcaggccgtcgtcgcgctgccgggcggcgacgcgatcggc
tcgcgcccgctggacatgcaccagaacggcctgcgcaagctgggcgcgacgagcacgatc
gagcacggctgcgtcgtcgcgaaggccgagacgctggtcggcgcgcagatctggctggac
ttcccgagcgtcggcgcgaccgagaacatcctgatggcggccgtgctggccgagggcacc
acggtcatcgacaactgcgcgcgcgagccggagatcgtcgacatctgcacgatgctcacc
gagatgggcgcgaagatcgaaggcgccgggacgtcgacgctgaccgtgcacggcgtggag
cagctgcacccgaccacgcacagcgtgatcggtgaccggatcgtgggcgccacctgggcg
ttcgccgcctcgatgacccgtggcgacatcaccgtgcgcggggtcaacccgcaccacctc
gacctggtgctgaacaagctgcaccaggccggcgcggacgtcgaaacgttcggggacaag
ggtttccgcgtggtccagccggagcgcccgaaggcggtcgactgggtgacgctgccgtac
ccgggcttcgcgaccgacctgcagccgttcgcggtggcgctgtcggcggtgtcggaaggc
acgtcgatgatcacggagaacgtctacgaggcccggttccgcttcatcgaagagatggtc
aggttatcgggcgacgcccgcacggacggccaccacgcggtggtccgcggcgtcgaacgg
ctgtcgagcgcgccggtctgggcgtcggacatccgcgcgggcgcggggctggtgctcgcc
ggcctgtgcgcggacggcgtcaccgaggtctgggacgtcttccacatcgaccgcggctac
ccgcacttcgtcgaaaacctcaaccgcctgggcgcgaacatcaagcgcgttgcgggggag
cctgagcggaagtaa

DBGET integrated database retrieval system