KEGG   Amycolatopsis mediterranei S699: RAM_42445Help
Entry
RAM_42445         CDS       T01822                                 

Definition
beta-N-acetylhexosaminidase
Orthology
K12373  
hexosaminidase [EC:3.2.1.52]
Organism
amn  Amycolatopsis mediterranei S699
Pathway
Other glycan degradation
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:amn00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    RAM_42445
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    RAM_42445
Enzymes [BR:amn01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     RAM_42445
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
9091900..9093465
Genome map
AA seq 521 aa AA seqDB search
MRLSRAVLTAAVVSLTAAGLPASAVAAAAAPERSVTDVVPAPVSAKADPRGEFRLTPSTV
ITADHGAGQVADYLRGLLRPATGFPLPVVPNAAGLPALSLKLGHDARIGTEGYELKVARD
GVTVKANTADGLFEGVQSLRQLLPSAIDAKRVQHRTWTVAGGTILDYPRFAERGAMLDVA
RHFFRPDQVKLYLDQIAQYKVNTLHLHLADDQGWRIEIKSWPKLATVGGKTAVDGDPGGY
YTQAQYQDIVAYAASRHITVIPEIDMPGHTNAAQSTYAELNCDGKAVPVRTDTEVGYSSL
CISSPITYKFVEDVVRELAALTPGPYLHIGGDEAHSTPPADYLTFERKVQPIVAKYGKKV
TGWHEIAKSVPPVSAVPQYWDFGGDNPDVAAAAARGNKILMSPANYAYLDMKYNAQTPLG
QDWAALIEVKDGYNWDPASLVNGVGESQVAGVEAPLWTETIRTSDDIEYMAFPRLPGIAE
IGWSPKSTHNWNAYRARLAKQAPRWVAQGIDFYRSPQVDWK
NT seq 1566 nt NT seq  +upstreamnt  +downstreamnt
atgcgcttgtccagagccgtcctgaccgcggccgtcgtgagtctcacggccgccggcctg
cccgcttccgcggtggccgccgcggccgctcccgaacggagcgtgaccgacgtcgtcccg
gcgcccgtctccgcgaaggccgatcctcgcggtgaattccggctcacgccgtccaccgtg
atcaccgccgaccacggcgccggccaggtcgcggactacctgcgcggcctgctgcgcccg
gctaccggcttcccgctgccggtcgtgccgaacgccgccggcctgcccgcgctctcgctg
aagctgggccacgacgcgcggatcggcaccgagggttacgagctgaaggtcgcacgcgac
ggcgtcacggtgaaagccaacaccgccgacgggctcttcgaaggcgtccagtcgctgcgg
cagctgctgccgtcggcgatcgacgcgaagcgcgtgcagcaccggacgtggaccgtcgcc
ggcggcacgatcctcgactacccgcgcttcgccgagcgcggcgcgatgctcgacgtcgcc
cggcacttcttccggcccgaccaggtgaagctgtacctcgaccagatcgcccagtacaag
gtcaacacgctgcacctgcacctggccgacgaccagggctggcggatcgagatcaagagc
tggccgaagctggccacggtcggcggcaagaccgcggtcgacggcgacccgggtggctac
tacacgcaggcgcaataccaggacatcgtcgcgtacgcggcttcgcggcacatcacggtg
atcccggagatcgacatgccgggccacaccaacgcggcgcagtcgacgtacgccgagctg
aactgcgacgggaaggccgtgccggtgcgcacggacaccgaggtcggctacagctcgctg
tgcatctcctcgccgatcacctacaagttcgtcgaggacgtcgtgcgcgagctggcggcc
ctcacgcccggcccgtacctgcacatcggcggcgacgaggcgcactcgacaccgcccgcg
gactacctgaccttcgagcggaaggtgcagccgatcgtcgccaagtacggcaagaaggtc
accggctggcacgagatcgccaagtcggtcccgccggtgtcggcggtgccgcagtactgg
gacttcggcggcgacaacccggacgtcgcggcggccgcggcgcgcggcaacaagatcctg
atgtcgccggcgaactacgcctacctcgacatgaagtacaacgcgcagacgccgctcggc
caggactgggccgcgctgatcgaggtgaaggacgggtacaactgggatccggcgtcgctg
gtgaacggcgtcggcgagagccaggtcgcgggcgtcgaagcgccgctgtggaccgagacg
atccggaccagcgacgacatcgagtacatggcgttcccgcggctcccgggcatcgcggag
atcggctggtccccgaagtcgacgcacaactggaacgcctaccgcgcgcggctggcgaag
caggccccgcgctgggtggcgcagggcatcgacttctaccgctccccgcaggtcgactgg
aagtga

DBGET integrated database retrieval system