KEGG   Amycolatopsis mediterranei S699: RAM_43985Help
Entry
RAM_43985         CDS       T01822                                 

Definition
glucan 1,4-alpha-glucosidase
Orthology
K01178  
glucoamylase [EC:3.2.1.3]
Organism
amn  Amycolatopsis mediterranei S699
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:amn00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(9406465..9408630)
Genome map
AA seq 721 aa AA seqDB search
MRKLIFGALAGLLVTGLIPATAAAQGEAPGAPGTHPSWLPANKTGFGTAHDRSSNVWFTL
QGGQLSEVYYPDMSTPSVRSMDFVVTDGRSFAVTDYSAKSQQVRRTGDDSLTYEQTVTDD
QHRWRLRKTYVTDPAATTVLVDVDFQSLTGRPYQLYAVADPDLTNDGSDDSAARSGDALT
AQDATNAAALTAQPAFTTTSVGYAGASDGNTQLTKTFKLDRYDTAAKGNVVLTGRTNADG
VRDRHVTVALGMGAKAADALKSAQASQRRGFRDIARAYDRGWQQYLRGVAKPPSSLKTGA
ERDLYKASMLTLAASEDKHHPGAFIASPSMPWRFGNNDPEWSPSGTYHLVWPRDLYQIAT
GLAAGGDTAAANRAVSYMFGTQQQPDGHLPQNSRVDGVPYWTSIQLDETAFPIVLAQQLG
RNDLWPGVRKAADFILGYKGPNGQASPYTQQERWEEQDGWSPSTIASVIAGLVCAADIAS
HNGAAADAARYLAAADKMKADLPKQTITTNGPLSKDPYFVRLTKDANANAGTTYNLGNSS
VTMDQRAVTDAGFLDLVRLGVYRADDPVIRNSVRVTDKEIAFTTPTGQFWHRYTKDGYGE
QADGSPWDYTFPAESRTTFGRLWPLLAGERGEYELTLGDRASAARRLRDLGRVSSSAETM
PEQVWDENPPSGQTGFPAGTPTTSATPLAWTHAQYVRLAWDVKAGSVLETPRVVRCHFLG
C
NT seq 2166 nt NT seq  +upstreamnt  +downstreamnt
atgcgcaaactcatcttcggcgccctcgccgggctgctggtcaccggcctgatcccggcg
accgcggcggcgcagggggaggctcccggtgcccccgggacccatcccagctggctaccc
gcgaacaagaccggcttcgggaccgcgcacgaccggtccagcaacgtctggttcaccctc
cagggcgggcagctgtccgaggtctactacccggacatgtccacgcccagcgtccgctcg
atggacttcgtcgtcacggacggccgcagcttcgccgtcaccgactactcggcgaagtcg
cagcaggtccggcggaccggcgacgacagcttgacgtacgagcagaccgtcaccgacgac
cagcaccggtggcgcctccgcaagacctacgtcaccgacccggccgccacgaccgtgctg
gtggacgtcgacttccagtcgctcaccgggcggccctaccagctctacgcggtcgccgac
ccggacctcaccaacgacggctccgacgactcggccgctcgctcgggtgacgccctcacg
gcgcaggacgccacgaacgccgctgcgctgaccgcgcagcccgcgttcaccacgaccagt
gtcggctacgcgggcgcctccgacgggaacacccagctcaccaagaccttcaagctcgac
cggtacgacaccgcggccaagggcaacgtcgtgctgaccggccggacgaacgccgacggc
gtccgcgaccggcacgtcaccgtggccctcggcatgggcgcgaaggccgccgacgcgctc
aagagcgcgcaggcgtcgcagcgacgcggcttccgcgacatcgcgcgcgcctacgaccgc
ggctggcagcagtacctgcgcggggtcgccaagccgccgtcgtcgctgaagaccggcgcc
gagcgcgacctgtacaaggcgtcgatgctgacgctcgccgcgagcgaggacaagcaccac
cccggcgccttcatcgcgtcgccgagcatgccgtggcggttcgggaacaacgaccccgag
tggtcgccgtcgggcacctaccacctggtctggccgcgtgacctctaccagatcgcgacc
gggctggccgccggcggcgacacggccgccgcgaaccgcgcggtgtcgtacatgttcggc
acgcagcagcagcccgacgggcacctgccgcagaacagccgggtcgacggcgtgccgtac
tggacgtcgatccagctcgacgagaccgcgttcccgatcgtgctcgcccagcagctgggc
cggaacgacctgtggcccggcgtccgcaaggccgccgacttcatcctcggctacaagggg
ccgaacgggcaggcgtcgccgtacacccagcaggagcgctgggaggagcaggacggctgg
tccccgtcgacgatcgcctcggtgatcgccgggctcgtctgcgccgcggacatcgcttcg
cacaacggcgcggccgccgacgccgcccgctacctcgccgcggccgacaagatgaaggcc
gacctgccgaagcagacgatcaccacgaacgggccgctgtcgaaggacccgtacttcgtc
cggctcacgaaagacgcgaacgcgaacgccgggacgacgtacaacctcggcaactcgagc
gtgacgatggaccagcgtgcggtcaccgacgcgggcttcctcgacctggtccggctcggc
gtctaccgcgccgacgacccggtgattcgcaacagcgtgcgcgtgaccgacaaggaaatc
gcgttcactacgccgaccggtcagttctggcaccggtacacgaaggacggctacggcgag
caggccgacggctcgccgtgggactacacgttcccggcggagagccgcacgacgttcggc
cggttgtggccgctgctcgccggcgagcgcggcgagtacgagctgacgctcggtgaccgc
gcctcggccgcgcggcggctgcgtgacctcggccgggtgagcagctcggcggagaccatg
ccggagcaggtgtgggacgagaacccgccgtccgggcagaccggcttcccggccggcacg
cccacgacgtcggcgaccccgctggcctggacgcacgcccagtacgtccggctcgcctgg
gacgtcaaggcgggctcggtgctggagacgcctcgagtggtccgctgtcacttcctcggc
tgctga

DBGET integrated database retrieval system