KEGG   Amycolatopsis mediterranei S699: RAM_45195Help
Entry
RAM_45195         CDS       T01822                                 

Definition
beta-N-acetylhexosaminidase
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
amn  Amycolatopsis mediterranei S699
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:amn00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    RAM_45195
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    RAM_45195
Enzymes [BR:amn01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     RAM_45195
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
9662841..9664598
Genome map
AA seq 585 aa AA seqDB search
MLAFTGVGVATAASAPRLSADAQAEAAATQALRGLTLEQKVGQLFVTWVNGKSADEVHPK
NQTDFGVDTPAQVIEKYHLGGVIYFNNDSRDNFDDPVQVAKLSNGLQQAAVRSGAHIPLQ
IAADQEGGTVTRMGAPATEFPNAMAVSAGRDTNRATQAATILGRELRAVGINQDFAPDSD
VNSNPVNPVIGVRSFSGQPGLASDFVTAEIKGFQDSGFPTKTVAATAKHFPGHGAAPTDS
HTGLPRIDSTEAQWRATDVPPFKAAIAAGVDSIMSAHIQFPSLDPSLEPATLSQPIITGR
LRNELGYRGVVITDSLEMEGVRRLHSDAEIPVLALKAGVDQLLMPVHLELAINSVIAAVK
SGDIPMRRIDQSVLRVLKLKFLRGILFSPFVDTGRVMKTVGIPSSLETAQDIADRGITAI
ANDAGLLPLKQKPATTLVTGWGVSTTATLAQKLTAHGTAATAYQTGQVPTDAQIAQAVAK
AQSADLVVVLTNNIATYPLQTNLLNALQATGKPVVAVAAQIPYDAGYPSTVRTWLATYGY
ITPTLEALAKVIVGETKPIGKLPVDIPAGADMQTVKYPFGHGLTW
NT seq 1758 nt NT seq  +upstreamnt  +downstreamnt
gtgctcgccttcaccggtgtgggtgtcgcgaccgcggcgagcgcaccccggttgagcgcg
gacgcgcaggccgaggccgcggcgacacaggcgctgcgtgggctgacgctcgagcagaag
gtcgggcagctgttcgtcacctgggtgaacggcaagtccgccgacgaggtccacccgaag
aaccagaccgacttcggcgtcgacacccccgcgcaggtcatcgagaagtaccacctcggc
ggggtcatctacttcaacaacgactcgcgcgacaacttcgacgaccccgtgcaggtcgcg
aagctgtccaacggcctccaacaggccgccgtccggagcggggcgcacatccccctgcag
atcgccgccgaccaggagggcggcacggtcacgcggatgggcgcaccggccaccgagttc
ccgaacgccatggccgtctccgccgggcgggacacaaaccgcgcgacgcaagcggcgacc
atcctcggccgcgaactgcgggccgtcgggatcaaccaggacttcgcgcccgattcggac
gtcaactccaaccccgtcaacccggtcatcggcgtgcggtccttctccgggcagcccggc
ctggccagcgacttcgtcaccgccgagatcaagggcttccaggactccggcttcccgacc
aagaccgtggcggcgacggccaagcacttccccgggcacggtgccgcaccgaccgacagc
cacaccgggctgccgcggatcgacagcaccgaggcgcagtggcgggccaccgacgtgccg
ccgttcaaggccgcgatcgcggccggcgtcgactcgatcatgagcgcgcacatccagttc
cccagcctcgacccctcgctcgagcccgcgacgctgtcacagccgatcatcaccggccgg
ctgcgcaacgagctcggctaccgcggcgtcgtgatcaccgactccctcgagatggagggc
gtgcgcaggctgcacagcgacgccgagatcccggtgctcgcgctcaaggcgggcgtcgac
cagctgctcatgccggtgcacctcgagctcgccatcaactcggtcatcgccgccgtcaag
tccggcgacatcccgatgcggcggatcgaccagagcgtgctgcgcgtgctcaaactcaag
ttcctgcgcggcatcctcttctcgccgttcgtcgacaccggccgggtgatgaagaccgtc
ggcatcccgtcgagcctcgagaccgcgcaggacatcgccgaccgcggcatcacggccatc
gcgaacgacgccggtctcctgcccctgaagcagaagcccgcgacgacgctcgtcaccggc
tggggcgtctccacgacggcgaccctcgcgcagaagctgaccgcccacggcacggccgcg
acggcctaccaaaccggtcaggtcccgacggatgcccagatcgcgcaggccgtcgccaag
gcgcagagcgccgatctcgtcgtcgtgctgaccaacaacatcgccacctacccgctgcag
acgaacctgctcaacgcgctgcaggccaccgggaagccggttgtcgcggtcgccgcacag
atcccctacgacgcgggctacccgagcaccgtccggacctggctggccacctacggttac
atcacgccgaccctcgaggcgctggccaaggtgatcgtcggcgagacgaagccgatcggg
aagctgccggtggacatccccgcgggggccgacatgcagaccgtgaagtacccgttcggc
cacgggctgacctggtga

DBGET integrated database retrieval system