KEGG   Amycolatopsis mediterranei S699: RAM_45240Help
Entry
RAM_45240         CDS       T01822                                 

Definition
acetyl-CoA synthetase (EC:6.2.1.1)
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
amn  Amycolatopsis mediterranei S699
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:amn00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    RAM_45240
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    RAM_45240
   00620 Pyruvate metabolism
    RAM_45240
   00640 Propanoate metabolism
    RAM_45240
  Energy metabolism
   00680 Methane metabolism
    RAM_45240
Enzymes [BR:amn01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     RAM_45240
Lipid biosynthesis proteins [BR:amn01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   RAM_45240
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
9672977..9674959
Genome map
AA seq 660 aa AA seqDB search
MTEQSPALDNLLTESRTFPPSEDFAAQANAKADLYAEADADREAFWAKQAERLTWDTKWT
TVLDWTNAPFAKWFVGGKLNVAYNCVDRHVESGHGEQVAIHWVGEPGDTRDITYAELKTE
VSKAANALASLGVTAGDVVAIQLQMVPEAIFAMLACARIGALHNVVFGGFSPTALRARVD
DAAAKVVITSDGQFRRGKAAPMKANVDEALEGAETVEKVIVVKRTGDKLEGDVPWTDGRD
LWWHELVDGQSEEHTPKAFDSEHPLFILYTSGTTGKPKGILHTSGGYLTQTAYTHHNVFD
HKAGEDVYWCTADIGWITGHSYIVYGPLANRVTQVVYEGTPNTPHEGRHWEIIQKYKVSL
YYTAPTLIRTFMKWGAEIPEKYDLSSLRVLGSVGEPINPEAWIWYRENIGAGRTPIVDTW
WQTETGAIMISPLPGVTSTKPGSAQKALPGISAKVVDDQGNEVGPGGGGYLVLDKPWPSM
LRGVWGDEERFKDTYWSRFKDQGFYFAGDGAKYDNDGDIWLLGRVDDVMNVSGHRISTTE
VESALVSHPTVAEAAVVGATDPTTGQGIVAFVILRGNAVDGGEEAIQALRNHVAKEIGPI
AKPRQIMVVPELPKTRSGKIMRRLLRDVAENRQVGDVTTLADSSVMDLISSGLKSGKSEE
NT seq 1983 nt NT seq  +upstreamnt  +downstreamnt
atgaccgagcagtccccagccctggacaacctgctcaccgagagccgcaccttcccgccc
agcgaagatttcgctgctcaggccaacgcgaaggccgacctctacgccgaggcggacgcc
gaccgcgaagcgttctgggcgaagcaggccgagcggctcacgtgggacacgaagtggacc
acggtactggactggaccaatgcaccgttcgcgaagtggttcgtcggcggcaagctgaac
gtcgcctacaactgcgtcgaccggcacgtcgagtccgggcacggcgagcaggtcgcgatc
cactgggtcggcgagccgggtgacacccgggacatcacctacgccgagctgaagaccgag
gtttccaaggccgccaacgcactcgcgtcgctgggcgtcaccgccggcgacgtcgtggcg
atccagctgcagatggtccccgaggccattttcgcgatgctcgcgtgcgcgcggatcggc
gcgctgcacaacgtcgtcttcggcggcttctcgccgacggcgctgcgggcccgcgtcgac
gacgccgccgcgaaggtcgtgatcacctccgacggccagttccgccgcggcaaggccgcg
ccgatgaaggccaatgtcgacgaagcgctcgaaggcgccgaaaccgtcgagaaggtcatc
gtcgtgaagcgcacgggcgacaagctggagggcgacgtcccgtggaccgacggtcgcgac
ctgtggtggcacgagctcgtcgacggacagtccgaagagcacactcccaaagcgttcgac
agcgagcacccgctgttcatcctctacacgtccgggacgaccgggaagccgaagggcatc
ctgcacacctccggcggctacctgacgcagaccgcgtacacgcaccacaacgtcttcgac
cacaaggccggcgaagacgtctactggtgcaccgccgacatcggctggatcaccggccac
agctacatcgtctacggccccctcgccaaccgcgtcacgcaggtcgtctacgaaggcacg
ccgaacaccccgcacgaggggcggcactgggagatcatccagaagtacaaggtctccctc
tactacacggcgccgacgctgatccgcacgttcatgaagtggggcgcggaaatcccggag
aagtacgacctgtcgtcgctgcgggtgctgggctcggtcggcgagccgatcaaccccgag
gcgtggatctggtaccgcgagaacatcggcgccggccggaccccgatcgtcgacacgtgg
tggcagaccgaaaccggcgcgatcatgatctcgccgctgccgggcgtcacctcgaccaag
ccgggctcggcgcagaaggcgctgccgggcatctccgcgaaggtcgtcgacgaccagggc
aacgaggtcggcccgggcggcggcgggtacctggtgctcgacaagccgtggccgtcgatg
ctgcgcggggtctggggcgacgaggagcgcttcaaggacacctactggtcgcggttcaag
gaccagggcttctacttcgccggcgacggcgcgaagtacgacaacgacggcgacatctgg
ctgctgggccgcgtcgacgacgtcatgaacgtgtccggccaccgcatctcgacgaccgag
gtcgagtcggcgctggtctcgcacccgacggtcgccgaggccgcggtcgtcggcgcgacc
gacccgacgaccggccagggcatcgtcgcgttcgtcatcctgcgcggcaacgccgtcgac
ggtggcgaagaggcgatccaggcgctgcggaaccacgtcgcgaaggagatcgggccgatc
gcgaagccgcggcagatcatggtcgtgccggagctgccgaagacgcgttcgggcaagatc
atgcgccgcctgctgcgcgacgtcgcggagaaccggcaggtcggcgacgtcaccacgctg
gccgactcgtcggtgatggacctgatctcgtcgggcctgaagtcgggcaagtcggaggag
tga

DBGET integrated database retrieval system