KEGG   Amycolatopsis mediterranei S699: RAM_45935Help
Entry
RAM_45935         CDS       T01822                                 

Definition
limonene-1,2-epoxide hydrolase
Orthology
K10533  
limonene-1,2-epoxide hydrolase [EC:3.3.2.8]
Organism
amn  Amycolatopsis mediterranei S699
Pathway
Limonene and pinene degradation
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:amn00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    RAM_45935
Enzymes [BR:amn01000]
 3. Hydrolases
  3.3  Acting on ether bonds
   3.3.2  Ether hydrolases
    3.3.2.8  limonene-1,2-epoxide hydrolase
     RAM_45935
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(9810702..9811127)
Genome map
AA seq 141 aa AA seqDB search
MVTGFLKALEDLDIDRALTFAASDIVYQNVPLPPARGVAAVEKQLRLMARFGSGFEARTH
HIASDGNVVLTERTDVLRRGAWEAEFWVCGTFEVEGGRIVLWRDYFDWTTVLAASAKGAG
RVALAGARTLLDRYKGRQAVR
NT seq 426 nt NT seq  +upstreamnt  +downstreamnt
gtggtgaccggtttcctgaaagcgctcgaagacctcgacatcgaccgcgcgctgacgttc
gcggcgagcgacatcgtgtaccagaacgtgccgttgccgcccgctcgcggcgtcgccgcg
gtcgagaagcagctgcgtctgatggcccgcttcggttccgggttcgaagcgcggacgcac
cacatcgcctcggacggcaacgtcgtgctcaccgaacgcaccgacgtgctgcgccgcggc
gcgtgggaagcggagttctgggtgtgcggcacgttcgaggtcgaaggcggccggatcgtg
ctctggcgcgactacttcgactggacgacggtgctggccgcgagcgcgaagggcgccggg
cgggtcgcgctggccggcgcgcgcacgctcctcgaccggtacaaggggaggcaggcggtg
cgctag

DBGET integrated database retrieval system