KEGG   Amycolatopsis mediterranei S699: RAM_47780Help
Entry
RAM_47780         CDS       T01822                                 

Definition
ribokinase
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
amn  Amycolatopsis mediterranei S699
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:amn00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    RAM_47780
Enzymes [BR:amn01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     RAM_47780
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(10177687..10178556)
Genome map
AA seq 289 aa AA seqDB search
MNSDVLVVGSANADLVVAVDRRPGGGETVLAGDTVLSPGGKGANTAVAAGRLGADVALLG
AVGDDPYGRLLLDSLRAAGVDTGLVRTSERPTGIAYITVTPDGENSILVSPGANSSLEPA
DVDAVFDGVEIMVVSLEVPLPTVEHAVARAAEKGVRVLLNLSPAAKLSPETLARLDVLLV
NEHEAAWLTGPGADFRKLLDLGPRAAVVTLGAAGAVVVEAGSVSRVESPKVEAVDTTGAG
DAFAGALAASLADGADLVSAAKRAVRVAAFSVTRHGAQPSYPTAADLGE
NT seq 870 nt NT seq  +upstreamnt  +downstreamnt
atgaactccgacgtcctcgttgtgggatccgccaatgccgacctcgtcgtcgcggtggat
cggcggccgggcggtggggagacggtgctggccggcgacaccgtgctctcgccgggcggc
aagggcgccaacacggcggtcgcggcgggccggctcggcgcggacgtcgcgctgctcggg
gccgtcggcgacgatccctacggcaggctgctgctcgattcgctccgcgccgccggcgtc
gacaccgggctcgtgcgcaccagcgaacggccgaccggcatcgcctacatcaccgtcacc
ccggacggcgagaactcgatcctcgtctcccccggcgccaactccagcctggagcccgcc
gatgtcgacgccgttttcgacggggtggagatcatggtcgtctccctggaggtgccgctg
ccgaccgtcgagcacgccgtcgcgcgggccgccgaaaagggcgtgcgggtgctgctgaac
ctgtcgccggcggcgaagctctccccggagacgctggccaggctcgacgtcctgctggtc
aacgagcacgaggccgcctggctcaccggacccggcgcggatttccggaagctgctcgac
ctcgggccgcgcgcggccgtcgtcacgctcggcgcggccggcgccgtcgtcgtcgaagcc
gggtcggtgagccgcgtggagtcgccgaaggtcgaggccgtggacaccaccggagccggg
gacgccttcgccggcgcgctcgccgcgtcgctcgccgacggtgccgacctggtctccgcg
gcgaagcgagccgtgcgcgtcgcggcgttcagcgtgacccggcatggcgcgcagccgtcc
taccccaccgccgccgacctgggggaatga

DBGET integrated database retrieval system