KEGG   Acetomicrobium mobile: Anamo_0077Help
Entry
Anamo_0077        CDS       T02151                                 

Definition
(GenBank) aldehyde:ferredoxin oxidoreductase
  KO
K03738  aldehyde:ferredoxin oxidoreductase [EC:1.2.7.5]
Organism
amo  Acetomicrobium mobile
Pathway
amo00030  Pentose phosphate pathway
amo01100  Metabolic pathways
amo01120  Microbial metabolism in diverse environments
amo01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:amo00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Anamo_0077
Enzymes [BR:amo01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.5  aldehyde ferredoxin oxidoreductase
     Anamo_0077
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AFOR_C AFOR_N Cdc6_C
Motif
Other DBs
NCBI-ProteinID: AFM20749
UniProt: I4BTZ2
Position
84321..86135
Genome map
AA seq 604 aa AA seqDB search
MFGYMGKVLRVNLSTKNITLEPLRMDWAKDFLGARGLGSRYLVEEVDPNVDPFSPDNKLI
FATGPVTGTLATSAGRFNVVTKGPLTGTIAASNSGGYFGPELKYAGYDMIIFEGKSANPV
YLWIYNDHVELRDASHVWGKDSYETTDALLSETDPEAKVACIGPAGERLVLFACVMNDKH
RAAGRTGVGAVMGSKNLKAVVVRGTGGIKLADKEAFLEALRKARKKIAEHPVTGGGLPAY
GTNVLVNVINAAGALPTRNFKEAWFEGADKISGETMAETILLKNKACASCASACGRVTKA
MGEIGEGPEYEAVWAYGAQCGVDNLEAICKANFICNKLGMDPITMGSTIGCAMELAELGL
IDEKKAGVSLHWGNAEAIVKLTEDTGYRRGFGEELALGSYRLGEKYGHPELSMSAKKQEM
PAYDPRALQGMGLEYATSNRGGCHVRGYLTSPEVLGIPEKLDPTDIASKPQWTKTFQDLT
AAVDSLGFCLFLTFALDAGDLAAQVAPIIGREVTAEELLLAGERIWNLERLFNLKAGISP
KEDTLPPRLLNEPIPAGPSKGRVNKLHEMLPKYYELRGWGKNGIPTKERLESLGLLDIAA
KYSL
NT seq 1815 nt NT seq  +upstreamnt  +downstreamnt
atgtttggctacatgggaaaggttttgcgcgtaaatttatcgaccaagaacataactctt
gagcctctgaggatggattgggctaaggactttttgggagccagaggcctgggaagcaga
tacctggtcgaagaggtcgaccccaatgtagatccctttagcccggataataaattgatt
tttgcaaccggtcctgtcaccgggactcttgccacctctgccggaaggttcaatgtggtt
acaaaggggcccttgactgggacgatagctgcttcgaattccggtggctactttggtccc
gagctgaagtacgcaggatacgacatgataattttcgaaggtaaatctgcaaacccggtg
tatttgtggatctacaacgatcacgtagagctgcgggatgcatctcacgtttggggaaag
gatagctatgagaccacagacgctcttctgtccgagaccgaccctgaggcgaaggttgcc
tgcattggtccggcgggagagaggttggtgctttttgcctgcgtgatgaacgataagcat
agggcagcaggcaggacaggcgttggtgccgttatgggttccaaaaacctcaaggccgta
gtcgtcaggggaaccggaggaataaagctcgcagataaggaagcctttttggaagcgctt
cgaaaggcacgcaaaaaaattgccgaacatcccgtcacgggtggaggattgcctgcctat
ggaactaacgtcctggtaaacgtcataaacgctgccggggccttgccgacgagaaacttt
aaggaggcatggttcgaaggagccgacaaaatttctggagagaccatggccgaaaccata
cttcttaaaaacaaggcatgtgccagctgcgcatccgcttgcggcagggtcaccaaggcc
atgggagagatcggcgagggtccagaatacgaagccgtttgggcatatggagcgcagtgc
ggcgtggataatctggaggccatctgtaaggccaacttcatttgcaataagcttggtatg
gacccgataaccatgggaagcaccataggatgcgccatggagttggccgagcttggcttg
attgacgaaaaaaaggcgggcgtatccctgcattggggaaacgctgaggcgatcgtaaag
ctaacagaggatacgggctacaggcgtggctttggtgaggagctagcccttgggtcttac
aggctcggcgagaagtatgggcatcccgagctttccatgtcggccaaaaagcaggaaatg
cccgcttacgatccaagggctttgcagggcatgggattggagtatgctaccagcaacaga
ggcggatgtcacgtaaggggttacttaacttcgccggaagtgctgggcatacccgagaag
ttggatccgacagatatcgcatctaagccgcagtggaccaagaccttccaggatttgacc
gctgccgtcgactctttgggcttctgcctgtttttgacctttgcgttggatgccggagac
cttgctgcccaggttgctccaattatcggcagagaggtcactgcagaagaactgcttctt
gccggcgagaggatatggaacttggagaggttattcaacttgaaggccggcatatcgcca
aaggaggacacgctaccgccacgattgcttaacgaacctatcccggcaggcccatctaag
ggcagggtaaataagcttcatgaaatgcttcccaagtactatgagctgcgtggatggggc
aaaaatgggatacctactaaggaaaggctggaaagcctgggattgctggacatcgcagcg
aaatattccctttaa

DBGET integrated database retrieval system