KEGG   Anaerobaculum mobile: Anamo_0095Help
Entry
Anamo_0095        CDS       T02151                                 

Definition
aldehyde:ferredoxin oxidoreductase
Orthology
K03738  
aldehyde:ferredoxin oxidoreductase [EC:1.2.7.5]
Organism
amo  Anaerobaculum mobile
Pathway
Pentose phosphate pathway
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:amo01200]
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:amo00030]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
102657..104570
Genome map
AA seq 637 aa AA seqDB search
MPFGYNGKILHLDLSSGSIDVESLREEFYRTYMGGSGLIGYYLLKMLKPGTDPLSPDNVL
VFAPGVMTGAPLGGMCRFAVGAKSPLTNAFGQSEAGGFWGPELKRAGYDAIVIKGKADKP
VYIYIDDGDVKICDAGHLWGKKTGEVQDIIRAEHDDPAIRVAQIGPGGENLVRFACITNE
LKHFNGRNGLGAVMGSKNLKAIAVRGKGQIPVADRKLMSEISKKFGTSVMENPLTRGLYE
NGTAASVLGNNAAGILPTKNFHYGEFDRADLISAKAMNEKILVAREGCYACPVRCKRAVK
SERFSVEPRFGGPEYETLASFGSLCMIDDVEVIAKANQMCNEYTLDTISTGMTIAFAMEC
FEAGILTKEETDGMELTFGNSEALLAMIEKIAKREGFGDVLAEGSKRASKIIGRGSEKFV
LTVKGQELPMHDPRGKYSVGLAYATSEKGADHMVAAHDTMIASKDQYSFSEIAPFGILEP
EKPTKFSPLKVRTFAYLTAWWSFFNAAGICDFVPVPRSSMPVNDVINALSAFTGWKTSLF
EAVKVGERALALARVFNAREGFGVEDDLLPERLHSPLKNGALKGNFLPKEDFLEALHLYY
AMMGWDEGGVPTEEKLLELGLDWLVEGYGKSDHISGQ
NT seq 1914 nt NT seq  +upstreamnt  +downstreamnt
gtgcccttcgggtataacggcaaaatactgcatctcgacctttcatcggggtcgatagat
gttgaaagcttacgagaagagttttatcgcacctatatgggtggttcgggtcttattggg
tattacctgctaaagatgcttaaacccgggacggatcccttaagtccggataacgtattg
gtcttcgctccgggcgtgatgacgggggctcccctgggcggaatgtgcaggtttgcagtt
ggcgccaaatctcccttgaccaatgcctttggccaatctgaagcaggagggttttggggg
cccgagctcaagcgtgccggctatgatgccatcgtcatcaagggaaaggctgacaagccc
gtatacatctacatagatgatggggacgtgaagatctgcgatgcaggtcatctttggggc
aaaaagaccggggaagttcaggatatcataagggccgagcatgacgacccggcaatacgt
gtcgcgcaaattggccccggaggggaaaacctcgtcagatttgcctgcataacgaatgag
cttaagcattttaacggcaggaacggcttaggtgcagtcatgggttccaaaaatttgaag
gctatagcggttcgcggtaaaggacagatccctgtagcagatcgcaagctcatgtccgag
atatcaaagaaatttggaacgtcagtgatggaaaacccgctgacaagggggctttacgaa
aatggcacggcagcgagcgttttgggaaacaacgctgcaggaatcttgccgaccaagaac
tttcactacggcgagtttgaccgtgcagacttgatctccgccaaggcgatgaacgaaaag
atactggtcgcacgtgaaggatgctatgcctgtcccgtaagatgtaagagagcggttaaa
tccgaacgcttctccgtcgaaccacgatttggggggccagaatacgagacccttgcctcc
tttgggtcgctttgcatgatagatgacgtagaagtaatagccaaggcaaaccaaatgtgc
aacgaatataccttggacaccatcagtacaggaatgaccatagcctttgccatggaatgc
tttgaggctggcatactgaccaaggaggaaaccgacggcatggaattaacctttggcaac
agcgaggccctccttgcaatgatagagaagatagctaaaagggaaggctttggcgatgtc
ttggccgaaggcagcaagagggcttcaaagatcataggaaggggttctgagaagttcgtc
ttgaccgttaaggggcaagagcttcccatgcatgaccctcgaggaaaatattctgtaggg
ctggcttatgccacctcggaaaagggcgccgatcacatggtcgcagcccacgatacgatg
atagcctcgaaagaccaatacagcttctccgagatagcgccctttggcatccttgaacct
gaaaaacccaccaagttttccccattaaaggtgcgaaccttcgcctaccttaccgcgtgg
tggagttttttcaacgcagccggcatatgcgatttcgtgcctgtgccgagaagttccatg
cctgtaaatgacgtgatcaatgccttaagcgcttttaccggatggaagaccagcctcttt
gaggccgtcaaagttggcgaaagggccttagccttagccagggtattcaacgcccgagag
ggttttggcgtcgaagacgacttgttgcccgaaaggttgcacagtccgcttaaaaacggc
gcccttaagggaaactttcttcccaaggaggatttcctggaggccctgcatctttattat
gccatgatgggttgggacgaagggggagtccctaccgaggaaaagctgttggaattgggg
cttgattggctggtcgaaggctatggcaaaagtgatcatatttcagggcaatga

DBGET integrated database retrieval system