KEGG   Anaerobaculum mobile: Anamo_0107Help
Entry
Anamo_0107        CDS       T02151                                 

Definition
ribulose-5-phosphate 4-epimerase-like epimerase or aldolase (EC:4.1.2.17)
Orthology
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
amo  Anaerobaculum mobile
Pathway
Fructose and mannose metabolism
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:amo00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    Anamo_0107
Enzymes [BR:amo01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     Anamo_0107
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
115621..116265
Genome map
AA seq 214 aa AA seqDB search
MLLEEKRQVIVEYGKKLITAGLTRGTGGNISVLDEKSKLMAISPSGMDYFETKPEDVVVM
DLNGKIVDGFRKPSSEWRMHLIFYQKREDVGAVVHTHSMFATTLATLHWEVPPASYLIAY
AGKKVPCAPYATFGTQEIADAAYDAMGEEYNAVLLANHGLIAVGPDMPSAFGIAETIEMV
CEIYYRAKCVGEPVILPDEEMELMLEKFKTYGQK
NT seq 645 nt NT seq  +upstreamnt  +downstreamnt
ttgcttttagaagagaaaaggcaagttattgttgaatatggcaagaaacttataacggcg
gggcttaccaggggcacgggaggtaatatcagtgttttagatgaaaaaagtaagttgatg
gcaatttctcccagcggcatggattattttgagaccaaacctgaagacgttgtggtcatg
gatttaaacggaaaaattgtggatgggtttagaaagccgtcaagcgaatggagaatgcat
ttaattttttatcaaaaaagggaagatgtcggtgccgttgtccatacgcattccatgttt
gctacaactcttgctaccctgcattgggaggttccccctgcaagctacctgatcgcctat
gccggaaagaaagtcccctgcgccccctacgccacctttggcacacaagagatagcagac
gccgcatatgatgctatgggcgaagaatacaatgctgttcttttggctaatcatggcctt
atcgcggttgggccggatatgccctctgccttcggaatagcagaaacaatagagatggta
tgtgaaatctactatagggccaaatgcgttggagagcctgtaattctgcccgacgaagag
atggaattgatgcttgagaagtttaagacctatgggcaaaagtga

DBGET integrated database retrieval system