KEGG   Anaerobaculum mobile: Anamo_0287Help
Entry
Anamo_0287        CDS       T02151                                 

Definition
chemotaxis response regulator containing a CheY-like receiver domain and a methylesterase domain
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
amo  Anaerobaculum mobile
Pathway
Two-component system
Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:amo00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Anamo_0287
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    Anamo_0287
Enzymes [BR:amo01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     Anamo_0287
Two-component system [BR:amo02022]
 CheA family
  CheA-CheYBV [MD:M00506]
   Anamo_0287
Bacterial motility proteins [BR:amo02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    Anamo_0287
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
275400..276482
Genome map
AA seq 360 aa AA seqDB search
MQVTGFMIKQIKVLVVDDSAFMRKVISDLLEEDPHIKVIDRARNGKEAVEKVIKLQPDVV
TLDVEMPQMDGLAALREIMRLKPTPVIMVSSLTRQGAETTIKALALGAIDFVTKPSGTIS
LDMKTVAQELREKVIAAASVAVEKLTGVAALPMIEVKKAPITRKGQVELVAIAASTGGPR
AIQRILEKIETTSIAPIVIVQHMPKGFTKSFAERLNEVSKLEVVEGYDNLPLKPGMAVVA
PGGSHLIVEYNKMRQLVCRLSDMPPLHSVKPAADLLFLSVADTVGGASLGVVLTGMGRDG
AEGAKAIRQKGGYVIAESSETCVIYGMPKAAVESGGVDEVLPLDVIPGRLEEMAVIRQKQ
NT seq 1083 nt NT seq  +upstreamnt  +downstreamnt
atgcaggtgacgggcttcatgattaagcagataaaagtattagtcgtcgatgattccgct
ttcatgcgcaaggtcatctccgatttattggaagaggatcctcacattaaagtaatagac
agggctagaaatgggaaagaggcagttgaaaaagttattaaattgcaacctgacgtggtt
acgcttgacgtcgaaatgccgcagatggatgggcttgctgccttgagggaaataatgcgc
cttaagcccactcccgtcatcatggtaagcagccttacgcgtcagggagcggaaacgacc
ataaaagctctggctttgggtgcgatcgacttcgtgaccaagccctcgggtaccatatca
ttggacatgaagacagtagctcaagaactcagagaaaaggtcattgctgctgcttctgtc
gcggttgagaagcttacaggcgttgctgccttgccgatgatagaggtaaaaaaagcacca
ataacaaggaaaggtcaggtggaattggttgctattgcagcgtctacgggagggcctcgg
gccatacagagaatattagaaaaaatagaaactacatctatagcaccaatagttatcgtt
cagcacatgcccaagggctttaccaagagctttgcggagagattaaatgaggtctctaaa
cttgaggtagtagaaggatacgacaatttaccattgaagcccggtatggcagtagttgcc
ccagggggtagtcatcttatagtagaatacaataagatgagacagttggtatgtcgttta
tcggacatgcctccacttcattcagttaagcccgctgcggatttgttgtttttaagcgtg
gccgatactgtcggcggagcatctttaggtgtagtacttacgggcatgggacgcgacgga
gccgagggggcaaaggcaattcgacaaaagggaggttacgtaatagcggaatcgagcgag
acctgcgtgatatacgggatgcccaaggcagcggtagaatctggtggtgtggatgaggtt
cttccgcttgatgtcatacctggacgcttagaagagatggccgtaataaggcaaaagcaa
tag

DBGET integrated database retrieval system