KEGG   Acetomicrobium mobile: Anamo_0287Help
Entry
Anamo_0287        CDS       T02151                                 

Definition
(GenBank) chemotaxis response regulator containing a CheY-like receiver domain and a methylesterase domain
  KO
K03412  two-component system, chemotaxis family, protein-glutamate methylesterase/glutaminase [EC:3.1.1.61 3.5.1.44]
Organism
amo  Acetomicrobium mobile
Pathway
amo02020  Two-component system
amo02030  Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:amo00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Anamo_0287
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    Anamo_0287
Enzymes [BR:amo01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     Anamo_0287
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.44  protein-glutamine glutaminase
     Anamo_0287
Two-component system [BR:amo02022]
 CheA family
  CheA-CheYBV [MD:M00506]
   Anamo_0287
Bacterial motility proteins [BR:amo02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    Anamo_0287
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CheB_methylest Response_reg Glycos_transf_2 Peripla_BP_2
Motif
Other DBs
NCBI-ProteinID: AFM20947
UniProt: I4BUJ0
Position
275400..276482
Genome map
AA seq 360 aa AA seqDB search
MQVTGFMIKQIKVLVVDDSAFMRKVISDLLEEDPHIKVIDRARNGKEAVEKVIKLQPDVV
TLDVEMPQMDGLAALREIMRLKPTPVIMVSSLTRQGAETTIKALALGAIDFVTKPSGTIS
LDMKTVAQELREKVIAAASVAVEKLTGVAALPMIEVKKAPITRKGQVELVAIAASTGGPR
AIQRILEKIETTSIAPIVIVQHMPKGFTKSFAERLNEVSKLEVVEGYDNLPLKPGMAVVA
PGGSHLIVEYNKMRQLVCRLSDMPPLHSVKPAADLLFLSVADTVGGASLGVVLTGMGRDG
AEGAKAIRQKGGYVIAESSETCVIYGMPKAAVESGGVDEVLPLDVIPGRLEEMAVIRQKQ
NT seq 1083 nt NT seq  +upstreamnt  +downstreamnt
atgcaggtgacgggcttcatgattaagcagataaaagtattagtcgtcgatgattccgct
ttcatgcgcaaggtcatctccgatttattggaagaggatcctcacattaaagtaatagac
agggctagaaatgggaaagaggcagttgaaaaagttattaaattgcaacctgacgtggtt
acgcttgacgtcgaaatgccgcagatggatgggcttgctgccttgagggaaataatgcgc
cttaagcccactcccgtcatcatggtaagcagccttacgcgtcagggagcggaaacgacc
ataaaagctctggctttgggtgcgatcgacttcgtgaccaagccctcgggtaccatatca
ttggacatgaagacagtagctcaagaactcagagaaaaggtcattgctgctgcttctgtc
gcggttgagaagcttacaggcgttgctgccttgccgatgatagaggtaaaaaaagcacca
ataacaaggaaaggtcaggtggaattggttgctattgcagcgtctacgggagggcctcgg
gccatacagagaatattagaaaaaatagaaactacatctatagcaccaatagttatcgtt
cagcacatgcccaagggctttaccaagagctttgcggagagattaaatgaggtctctaaa
cttgaggtagtagaaggatacgacaatttaccattgaagcccggtatggcagtagttgcc
ccagggggtagtcatcttatagtagaatacaataagatgagacagttggtatgtcgttta
tcggacatgcctccacttcattcagttaagcccgctgcggatttgttgtttttaagcgtg
gccgatactgtcggcggagcatctttaggtgtagtacttacgggcatgggacgcgacgga
gccgagggggcaaaggcaattcgacaaaagggaggttacgtaatagcggaatcgagcgag
acctgcgtgatatacgggatgcccaaggcagcggtagaatctggtggtgtggatgaggtt
cttccgcttgatgtcatacctggacgcttagaagagatggccgtaataaggcaaaagcaa
tag

DBGET integrated database retrieval system