KEGG   Anaerobaculum mobile: Anamo_0340Help
Entry
Anamo_0340        CDS       T02151                                 

Definition
dihydropteroate synthase
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
amo  Anaerobaculum mobile
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:amo00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(325301..326146)
Genome map
AA seq 281 aa AA seqDB search
MKPLALPRGRKLSFSGRPLIMGILNLTNDSFFPQSRIPDMTSLIERARKMIDDGADILDV
GAESTRPGADPVPLEEEERRLLPALKALRKEFPDVVISVDTYKSAIAEAALELGADIIND
ISGLSFDPDMAKVAARFGVPVIIMHIKGTPKDMQRDPRYEDVIGEIKDFLKEKIEYAVSC
GVNPEQIVIDPGLGFGKGHDHNLQILRHVQEFRSLGKPILIGHSRKGTISKILGCKGPEE
ALYGTLAISAYCAMNKIEIIRVHDVLENRHVVEMIDAIQRA
NT seq 846 nt NT seq  +upstreamnt  +downstreamnt
atgaaaccattggcgctgcccagggggcgaaagctaagcttcagcggaagaccgctcata
atgggaattttaaatcttaccaacgattccttttttcctcaaagcaggatacccgatatg
acctctttaattgagagggcaagaaaaatgatagacgacggagcggacatcttggacgta
ggggctgaatccacacgaccgggagcggaccccgtaccgttggaggaagaagaaagaagg
ttgctgcctgcccttaaggcattgagaaaggaatttcctgacgtcgtcatctcggtagac
acctacaaatcggcaatagcagaggcggccttagagcttggggctgatataataaacgac
atctccggattgtcgttcgaccccgacatggccaaagtggcggcaagatttggtgtcccc
gtaataataatgcacattaagggcacgccaaaggacatgcaaagggatccacgatacgaa
gatgtaataggcgaaataaaggattttcttaaagaaaaaattgaatatgccgtcagctgt
ggggtaaatccggagcaaattgtgattgatccaggattgggctttggcaaggggcatgat
cacaacctgcagatattaaggcatgtccaggagttcaggtccctgggcaagcccatactg
atcggccactcgcgaaagggaaccataagcaaaatactaggatgcaaaggtcccgaagaa
gccctttacggcactttggcgatctcagcatattgcgccatgaacaagatagaaataata
agggttcatgatgtactggaaaataggcacgtggtggaaatgattgatgccatccaaagg
gcttag

DBGET integrated database retrieval system