KEGG   Anaerobaculum mobile: Anamo_0413Help
Entry
Anamo_0413        CDS       T02151                                 

Definition
(RefSeq) threonine synthase
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
amo  Anaerobaculum mobile
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:amo00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Anamo_0413
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Anamo_0413
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Anamo_0413
Enzymes [BR:amo01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Anamo_0413
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
399330..400373
Genome map
AA seq 347 aa AA seqDB search
MVRLLERYVKYFPVTSGTPIISIGEGNTPLVRLDNLGVKLGIELYGKCEGLNPTGSFKDR
GMVLAVAKALEAGSKGIICASTGNTSASAAAYAAKAKLKCHVVLPAGKVAKGKLAQALMY
GANVLAVRGNFDVALDMTRRLASDLGLNIVNSVNPYRLWGQRSGAWEVSDEIGSPDWCVL
PVGNAGNITAYWAGFVQYKKAGLIDAIPKMIGVQAQGAAPLVTGKPFQNPETVATAICIG
NPVNAKKAMAAVKSSNGMFLAVSDEEILQAQRDLASSEGIFAEPASCATLAGLYKLKRNG
DLPKGIRVVMILTGNGLKDPMIVDYMVSPPKEVEADFDDLKEAIMSC
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
atggttcgcttactggaaaggtatgttaaatattttcccgtcacgtcaggcacgccgatc
atatcgataggcgagggcaacactcccttagttcgacttgacaatcttggcgtaaagctt
gggatcgagctttacggtaaatgcgaaggccttaaccccacaggctcctttaaggataga
ggcatggtacttgctgtggccaaggctttggaggcaggatctaagggcatcatatgcgct
tcgacgggaaacacttccgcttcggcagcggcttatgccgccaaggcaaaactcaaatgt
catgtcgtcttgcctgccggcaaagtggccaagggcaagcttgcacaggctttgatgtac
ggggcaaatgtattggccgttcgcggaaacttcgatgttgcacttgatatgacgcgcagg
ctggccagcgatctgggtttaaatatcgtaaactcggtaaatccttacaggctttgggga
cagagaagcggtgcctgggaggtctcagacgagataggatctccggattggtgcgtattg
cccgtgggaaatgcaggaaatataacggcctactgggcaggcttcgtccaatacaaaaaa
gcgggcctgattgacgcgatcccaaaaatgataggagtgcaagcccaaggtgctgccccc
ttggtaacgggcaagcccttccaaaacccggagacggttgccacggctatatgcatcggc
aatcccgtgaacgcaaaaaaggccatggctgccgttaaaagcagcaatggaatgtttttg
gcggtctccgacgaagagatacttcaggcacaaagggatctggcaagcagtgagggcata
ttcgccgagccggcttcctgtgccacgcttgctggcctttataagctgaagagaaacggc
gacttgccaaagggcataagggtcgtcatgatccttacgggtaatggattaaaggatcct
atgatagtcgattatatggtctcaccgccaaaagaggtggaggcggacttcgatgatttg
aaggaggcgataatgtcatgttga

DBGET integrated database retrieval system