KEGG   Anaerobaculum mobile: Anamo_0574Help
Entry
Anamo_0574        CDS       T02151                                 

Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
amo  Anaerobaculum mobile
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:amo00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Anamo_0574
   01230 Biosynthesis of amino acids
    Anamo_0574
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Anamo_0574
   00030 Pentose phosphate pathway
    Anamo_0574
   00051 Fructose and mannose metabolism
    Anamo_0574
   00052 Galactose metabolism
    Anamo_0574
  Energy metabolism
   00680 Methane metabolism
    Anamo_0574
Enzymes [BR:amo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Anamo_0574
Protein phosphatases and associated proteins [BR:amo01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Anamo_0574
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
555566..556531
Genome map
AA seq 321 aa AA seqDB search
MELKRIGILTSGGDAPGMNAAVRAATRCAIYRGLEVIGIRRGFEGLLESDVIPLTSRSVG
GIIHRGGTILRTARSERFKKPEGQVEALDRLKELDLDGLILVGGEGTFKGAWALYKKGFP
VVGVPGTIDNDIAGTDVTIGFDTAVNTALDAVRKLRDTASSHDRLFIVEVMGRNSGFLAS
AVALASGAEYVLVPEIPSDVEKLCEKLYNARRQGKTHSLIIVAEGAMSARDLAAKLKDTA
GYEARVTVLGHIQRGGSPTAFDATLASRMGAHAVKALLEGQSGIMTGSLWGQMVAHPLPV
AWEEKKPLSDEVLSLMEMLSI
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
atggagcttaaacgcatcggaattcttaccagcggcggcgacgcgcccggcatgaacgcc
gccgtaagggctgcgacgaggtgcgccatttacagggggcttgaggtcataggcatcagg
aggggctttgaaggattgcttgaaagtgacgtaattccccttaccagccgctccgtcggg
ggcatcatccacaggggaggtaccatccttcgcactgcccgaagcgagcgcttcaaaaag
ccagaaggacaggtggaggctttagaccgcctcaaagaactggaccttgacgggctgatt
ctcgtaggcggcgaaggaaccttcaaaggcgcctgggccctttacaagaaagggtttccc
gtagttggagtccccggaacaatagataacgacatcgcaggcacggatgtaacgatcggc
tttgataccgccgtaaataccgctttggatgcggtaagaaaattgcgcgatacggcctca
agccacgacaggctttttatagttgaggtcatgggcagaaattccgggttcctggcttcc
gcagtggcccttgcatcgggtgccgaatacgtgctcgtgccggagataccgtccgacgtt
gaaaagctttgcgagaagctttacaacgccaggcgccagggtaagactcattctttgatc
atcgttgccgaaggcgcgatgagcgcccgggacctggccgcaaagttaaaggacacggca
ggctacgaagcgcgcgttaccgtcctgggccacatacagcgcggcggaagccccacggcc
tttgacgccactttggcctcccgcatgggggctcatgcggttaaggccttgcttgaaggt
caatcaggcatcatgacaggatccctgtggggccagatggtagcgcatcccttgcccgtc
gcctgggaggagaaaaagcccttgagcgacgaggtgctctcgttgatggagatgctttcg
atatga

DBGET integrated database retrieval system