KEGG   Anaerobaculum mobile: Anamo_0670Help
Entry
Anamo_0670        CDS       T02151                                 

Definition
UTP-glucose-1-phosphate uridylyltransferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
amo  Anaerobaculum mobile
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:amo00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Anamo_0670
   00052 Galactose metabolism
    Anamo_0670
   00500 Starch and sucrose metabolism
    Anamo_0670
   00520 Amino sugar and nucleotide sugar metabolism
    Anamo_0670
Enzymes [BR:amo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Anamo_0670
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
641659..642534
Genome map
AA seq 291 aa AA seqDB search
MSDVRKCLFPVAGLGTRFLPVTKEIPKEMLPLIDKPVIQYGVEEAVASGCGQIIFITGRG
KRALEDYFDRSYELEQLLKERNKEDLYQLILSISSLADFAYVRQPEPLGLGHAILCAEAF
CNEPFGVILTDDVMISSKPVLRQLIEVREKLGGSVIALERVPHEETERYGIVDACLYSDN
IYKINDLIEKPKREKAPSDLAIMGRYVLSPAVFAHIRNIERGEGGEYQLTDALKSLLKEE
PLWGVVYEGERLDCGTKMGWFKSTIKMGLQDPELRKVVLEILNEEEVSEND
NT seq 876 nt NT seq  +upstreamnt  +downstreamnt
atgtctgatgtacgtaaatgtctttttcctgtggctggcttggggacgcgctttttgccc
gtgaccaaggaaatacccaaggagatgctgccgttgatagacaagcccgtgattcagtat
ggggttgaggaggctgtggcctccgggtgcggtcaaataatatttatcacgggaagaggg
aaaagggccctggaagactatttcgacaggtcgtatgagcttgagcagctcttgaaggag
cgcaacaaggaagacctttatcaattgatcttgtcgataagttcattggcagattttgca
tatgtcagacagccggaacctttgggcttaggacatgccatactctgcgctgaagcattc
tgcaatgagccctttggggtgatacttacagacgacgtgatgatctcttctaagcctgtg
ctaagacagctgatagaggttcgcgagaagttgggcggctcggtgattgcccttgaaaga
gtgccccacgaagaaacggagcggtacggcatagtcgacgcctgcttgtattctgataat
atatacaagatcaatgacctgatagaaaaaccgaagagggagaaggcgccgagcgacttg
gccataatgggcagatatgtgctctcccctgcggtgtttgcccatatccgaaacatagag
aggggagaggggggcgagtatcagcttacggatgcccttaaaagcttgctgaaggaagaa
ccgttatggggcgtggtatacgaaggcgaacgcctcgactgtgggaccaagatgggatgg
ttcaagtcaaccataaaaatggggcttcaggatcccgaattaagaaaagtggtgctggaa
atattgaacgaagaagaagtcagcgagaacgactag

DBGET integrated database retrieval system