KEGG   Anaerobaculum mobile: Anamo_0694Help
Entry
Anamo_0694        CDS       T02151                                 

Definition
agmatinase
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
amo  Anaerobaculum mobile
Pathway
Arginine and proline metabolism
Metabolic pathways
Module
Polyamine biosynthesis, arginine => agmatine => putrescine => spermidine
Class
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:amo00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
667221..668078
Genome map
AA seq 285 aa AA seqDB search
MMRFLKSGPCIRDARWILFGAPSDAAVSRRGGAQYAPDAIRWESLHIETYSPYLGEGLGK
ASFFDVGDLFFVPGDIQSSLLKIEKVTSSFARKGKRVFILGGDHLVSLGSVKGVLSKFSD
LHVVHFDAHADLRDYYLGSKYSHATVMRRVAEQLASPRHLHQFAIRSGTREEIEWGKRNV
DLHLIDFLEPLKEVLGKLEGCPIYVSLDIDVLDPSFAPGTGTPEPEGVSVTDLFKALRMF
KGHNVVGFDLVEISPPVDVNGVTSVLGAKIVREVLIMLGGDSVDQ
NT seq 858 nt NT seq  +upstreamnt  +downstreamnt
ttgatgcgctttctaaaaagtggaccatgcattagggatgccaggtggattctctttggg
gcaccttccgatgctgctgtatccagaagaggcggtgctcaatatgccccggatgcgatc
aggtgggaatcccttcatatcgagacctattccccctatttgggcgaggggttgggaaaa
gcctccttctttgatgtgggggatcttttttttgtaccgggagatatccaaagttcattg
ttgaagatcgaaaaggttacgtcctcttttgcgcgtaagggcaaaagggtcttcatcctt
ggaggagatcacctggtaagtttaggctctgtaaaaggggttttgtccaagttttcagat
cttcatgtggttcatttcgatgcccatgccgacctgagggattattatttgggcagcaaa
tacagtcacgctacggtcatgcgaagggtagcagaacaactggcaagccccaggcattta
caccaatttgcgataagatcaggcaccagagaggaaattgagtggggtaagagaaacgtc
gaccttcatctgatcgatttcctggagcccttaaaagaggtcttgggcaaactagaagga
tgtcctatatatgtgagcttggacatagacgtgttggatccctcctttgctcccggaacg
ggtacgcctgaaccggagggtgtcagcgttactgacctttttaaggccttacgcatgttc
aagggccacaacgttgttggcttcgacctggttgagatatctccacctgtcgacgtaaac
ggagtaacgtccgttttaggggccaaaattgtgcgagaggttttaattatgttgggaggt
gacagcgttgaccaataa

DBGET integrated database retrieval system