KEGG   Anaerobaculum mobile: Anamo_0704Help
Entry
Anamo_0704        CDS       T02151                                 

Definition
Holliday junction DNA helicase subunit RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
amo  Anaerobaculum mobile
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:amo00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Anamo_0704
Enzymes [BR:amo01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     Anamo_0704
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
675707..676297
Genome map
AA seq 196 aa AA seqDB search
MIRFISGLIVNIRENLVVIDVAGVGLEVTCSREALSLCRVGDKVTLPVYLHISESGPLLF
GFGDYSEREFFLMLKNVKGMGARTAISILRWLSAPELVKIIQDQNPERLERVPGIGHKTA
ERICFELKDKVKKVFAGETDLPEANDKLQVIRLALKELNFSDGEINKAIGILEKSQDIAC
QSEEKLLQQALRALIG
NT seq 591 nt NT seq  +upstreamnt  +downstreamnt
atgatcaggtttatctcagggcttatcgtaaacatcagagaaaatttggtagtaatagat
gttgcgggtgttggattggaggtcacctgttctcgtgaagccctctccttatgcagggtg
ggagataaggtgaccttgcctgtctacctccatataagcgaaagcggacctttgctcttt
ggctttggcgattattcggaaagggaatttttcttgatgttaaagaacgtaaagggcatg
ggagccaggacggcgatatctatacttcgatggctgtcggcgcctgaattggtaaagatc
atacaggatcaaaatccggagaggctggaaagggttcccggcataggtcacaagacagca
gagagaatctgttttgaattaaaggataaggttaaaaaggtttttgcaggcgaaaccgac
ctgcctgaggcaaacgataaacttcaggtaatcagattggccttgaaggagcttaatttc
agcgacggagaaataaacaaggctataggaatcttggagaaaagccaagacatcgcatgt
cagtcggaggaaaaattgcttcagcaggccttaagggctttgatcggatag

DBGET integrated database retrieval system