KEGG   Acetomicrobium mobile: Anamo_0767Help
Entry
Anamo_0767        CDS       T02151                                 

Definition
(GenBank) 1-deoxy-D-xylulose 5-phosphate reductoisomerase
  KO
K00099  1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
amo  Acetomicrobium mobile
Pathway
amo00900  Terpenoid backbone biosynthesis
amo01100  Metabolic pathways
amo01110  Biosynthesis of secondary metabolites
amo01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:amo00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Anamo_0767
Enzymes [BR:amo01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     Anamo_0767
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DXP_redisom_C DXP_reductoisom DXPR_C Semialdhyde_dh
Motif
Other DBs
NCBI-ProteinID: AFM21408
UniProt: I4BVV1
Position
734710..735876
Genome map
AA seq 388 aa AA seqDB search
MNKKRLAVVGATGSIGRSTLDICRRFPEAFEVRALAVRSNLKGLKALEGEFKPKFVVIYE
EAAARDYVPLFDGTRVLKGKEGLKLLVQEDLDHIVFASSGTDAIPALMTALARKMEVSLA
NKESLVVGGPWVMETVDSFDQLRPIDSEHSAIWQCLLGERREDIEEIALTASGGPFLHAT
YEEMKNATPEIALKHPTWRMGAKITIDSATLFNKGLEIIEACYLFSMPLDRVKAVVQPDS
LIHGCVRFCDGSSKLLLSKPDMRIPISFALSYPRRLRLDEAFHRPQITEWKVNFLKIDEE
KFPCYGLARRALQMGNAYPPILVGADEAAVEAFLGGVISMVDIFPLLERTLLSYNGPSNL
NSLEEAIALVDFGRREAGRLSRLFSERR
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
ttgaataaaaagagattggcggtcgttggagctaccggctccatcggaaggtcgactttg
gatatatgcaggaggtttcccgaagcttttgaggtcagggctttggctgtcagatcaaac
ctcaagggattgaaagccttagaaggggagtttaagccaaaatttgtggtaatttacgaa
gaagcggcagcgcgagattacgtgcctctctttgacggtacaagggttttaaaaggaaaa
gaggggctaaaactgcttgttcaggaagatctggatcatatcgtgtttgcctcgtctggg
acagatgcaatacctgccctcatgacggccctcgcgagaaaaatggaagtatcgctggca
aataaggaaagcttggtggtgggcggcccctgggtgatggagacggtagactcatttgat
cagttgcggccaatagacagcgagcacagcgcgatatggcaatgccttttaggagaaaga
agagaggatatcgaggagatcgccttgacggcatcgggtggtccttttttacatgcaact
tacgaggagatgaaaaacgcaacccccgaaattgccttgaagcatccaacctggagaatg
ggcgcaaagatcaccatcgatagtgcgactttattcaataaagggcttgaaataatagag
gcatgttaccttttttccatgccccttgatagggtcaaggccgtggttcagcccgattcc
ttaattcacggttgcgtgcgcttttgcgacggaagctccaaattgctcttaagcaaaccg
gacatgagaatcccaatttcctttgcattgtcataccctaggcgattgaggctagacgag
gcgtttcatcgtccgcagattaccgaatggaaagttaattttttgaaaatagacgaagag
aaattcccctgctatggcctagccaggcgggcattgcagatgggcaatgcctaccctcca
atattggttggtgccgacgaagctgcggttgaagctttcttggggggcgtcatctccatg
gtcgacatcttccccctgttggaaaggacacttttgtcctataatggaccgtcaaaccta
aatagcttagaagaggccattgcacttgtcgatttcggtcgtcgcgaagcaggaaggttg
agtcgcctttttagcgaaaggagataa

DBGET integrated database retrieval system