KEGG   Anaerobaculum mobile: Anamo_0818Help
Entry
Anamo_0818        CDS       T02151                                 

Definition
DNA replication and repair protein RecR
Orthology
K06187  
recombination protein RecR
Organism
amo  Anaerobaculum mobile
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:amo00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Anamo_0818
DNA repair and recombination proteins [BR:amo03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      Anamo_0818
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
782063..782680
Genome map
AA seq 205 aa AA seqDB search
MALSKPLEDLMRLFERFPGIGEKSARRMVLFLLQQPKGFSEALAEGIRKCSSSLHPCSIC
GNITDDDPCSICSDPFRDKSTLCIVESVEDLITLEQAGIYNGLYFVLGMLYSPLEGEEVS
PQVLERLVKRVSQGDIKEVILAFSPKVEGELTMNLITSVLDPLPVTVSRLSYGLPVGGSV
SFADRTTLHAALEARTCLKRGEGRQ
NT seq 618 nt NT seq  +upstreamnt  +downstreamnt
ttggctttgtcgaagccgttagaggatttgatgcggctatttgagaggtttcctggcata
ggagaaaagagtgccaggaggatggtgctttttttacttcaacagccgaaaggtttttcc
gaagcccttgccgagggcatacgtaagtgtagttcgtctctccatccatgcagcatatgt
ggaaatattaccgacgacgatccctgctcgatttgcagcgacccctttagggacaaatct
acgctgtgcatcgtagaatccgtcgaggacttaatcaccctagagcaggccggcatatat
aatgggctttatttcgtcctgggaatgttatattctcccttagagggtgaagaggtatca
cctcaagtcctggagcgtctcgttaagagggtatcgcagggagatataaaggaggtaata
ttggctttcagccccaaggtcgagggggagctgacgatgaacctgataacatcggttctg
gatcccttgcctgtaactgtaagcaggttgtcttatggattgcccgttggcggaagcgtg
agctttgcggacaggacaacgctacatgctgccttggaggctaggacatgcttaaaaaga
ggcgaaggcagacaataa

DBGET integrated database retrieval system