KEGG   Anaerobaculum mobile: Anamo_0818Help
Entry
Anamo_0818        CDS       T02151                                 

Definition
DNA replication and repair protein RecR
Orthology
K06187  
recombination protein RecR
Organism
amo  Anaerobaculum mobile
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:amo03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
782063..782680
Genome map
AA seq 205 aa AA seqDB search
MALSKPLEDLMRLFERFPGIGEKSARRMVLFLLQQPKGFSEALAEGIRKCSSSLHPCSIC
GNITDDDPCSICSDPFRDKSTLCIVESVEDLITLEQAGIYNGLYFVLGMLYSPLEGEEVS
PQVLERLVKRVSQGDIKEVILAFSPKVEGELTMNLITSVLDPLPVTVSRLSYGLPVGGSV
SFADRTTLHAALEARTCLKRGEGRQ
NT seq 618 nt NT seq  +upstreamnt  +downstreamnt
ttggctttgtcgaagccgttagaggatttgatgcggctatttgagaggtttcctggcata
ggagaaaagagtgccaggaggatggtgctttttttacttcaacagccgaaaggtttttcc
gaagcccttgccgagggcatacgtaagtgtagttcgtctctccatccatgcagcatatgt
ggaaatattaccgacgacgatccctgctcgatttgcagcgacccctttagggacaaatct
acgctgtgcatcgtagaatccgtcgaggacttaatcaccctagagcaggccggcatatat
aatgggctttatttcgtcctgggaatgttatattctcccttagagggtgaagaggtatca
cctcaagtcctggagcgtctcgttaagagggtatcgcagggagatataaaggaggtaata
ttggctttcagccccaaggtcgagggggagctgacgatgaacctgataacatcggttctg
gatcccttgcctgtaactgtaagcaggttgtcttatggattgcccgttggcggaagcgtg
agctttgcggacaggacaacgctacatgctgccttggaggctaggacatgcttaaaaaga
ggcgaaggcagacaataa

DBGET integrated database retrieval system