KEGG   Anaerobaculum mobile: Anamo_0863Help
Entry
Anamo_0863        CDS       T02151                                 

Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
amo  Anaerobaculum mobile
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:amo00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Anamo_0863
   01230 Biosynthesis of amino acids
    Anamo_0863
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Anamo_0863
   00051 Fructose and mannose metabolism
    Anamo_0863
   00562 Inositol phosphate metabolism
    Anamo_0863
Enzymes [BR:amo01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Anamo_0863
Exosome [BR:amo04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Anamo_0863
  Exosomal proteins of bladder cancer cells
   Anamo_0863
  Exosomal proteins of melanoma cells
   Anamo_0863
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(830098..830910)
Genome map
AA seq 270 aa AA seqDB search
MKKRIPFFAGNWKMNKGPSETERFVKELATAIVGDEAVFGAVKANEIEIGVFPPFVSLER
AKSAIESANALISLGAQNMHWEDSGAFTGEVSGTMIKETGCQYVILGHSERRHIFGETDD
MIEMKMRKAIALGIKPVLCVGETLEERDKGMTESVVEGQLKEAFKALGTPQTFEIGIVIA
YEPVWAIGTGRKASDEDAQRVCAFIRSFLESNFDSHVAQAVRILYGGSVKPDNAMGLMSQ
QDIDGALIGGASLDVSSFIGIIKNGMASNA
NT seq 813 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaagcgcattcccttttttgccggcaattggaagatgaacaagggaccgtctgaa
accgaaaggttcgttaaagaattggccaccgctatagttggcgatgaagctgtttttggg
gcagtaaaggccaatgaaattgagattggcgtctttccgcccttcgtaagcctggaacgc
gcaaagagcgccatagaatcagcgaacgccttgatatccctaggcgctcaaaacatgcat
tgggaagatagcggtgcctttacgggcgaggtttccggcacgatgatcaaggaaacgggc
tgtcaatacgttatccttggacatagtgaaaggcgtcacatatttggcgagaccgacgat
atgattgaaatgaagatgaggaaggcgattgccttaggcatcaagccggttctgtgcgta
ggagagaccttggaagaaagggataaaggaatgaccgaatccgtggtagaggggcaactg
aaggaggcctttaaagcccttggaacgcctcaaactttcgaaataggtatagttatagct
tacgagccagtttgggccattgggacgggccgtaaagccagcgatgaggacgctcaaagg
gtgtgtgccttcataaggagctttttagaaagcaacttcgactcgcacgtcgctcaagcg
gtccgcatcctttatggtggaagcgtcaagccggacaacgccatgggcttgatgtctcaa
caggatatcgacggagctttgattggcggcgcatcactggatgtcagcagttttattggc
ataatcaaaaatggaatggcctcaaacgcatag

DBGET integrated database retrieval system