KEGG   Anaerobaculum mobile: Anamo_1011Help
Entry
Anamo_1011        CDS       T02151                                 

Definition
(RefSeq) nicotinamidase-like amidase
  KO
K08281  
nicotinamidase/pyrazinamidase [EC:3.5.1.19 3.5.1.-]
Organism
amo  Anaerobaculum mobile
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:amo00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    Anamo_1011
Enzymes [BR:amo01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.19  nicotinamidase
     Anamo_1011
    3.5.1.-  
     Anamo_1011
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
974626..975201
Genome map
AA seq 191 aa AA seqDB search
MPICKTDALIVVDVQVDFCPGGNLAVPGGDEIVAIVNELVELFEKRGGLVIFSRDWHPQR
HKSFRDEGGTWPPHCVQNTKGAEFHLDLLIPDSAIVVSKATDVAREAYSAFDGTGLSETL
KAAGTERIFVCGLATDFCVKSTAMDARKLGYDTYVVLDASRGISEESVRASLEEMKETGI
KIVKSFEIESL
NT seq 576 nt NT seq  +upstreamnt  +downstreamnt
atgccaatatgcaagactgatgccctgatagtcgtggatgttcaggtggacttctgtccc
ggaggaaatctggctgttccgggaggtgatgagatagttgcgatcgtaaatgagcttgtc
gaactgtttgaaaaaaggggcggattggtcatcttctcgcgagactggcacccgcaacgt
cataagagcttcagggatgaaggcggcacttggcctccccactgcgttcaaaatacgaag
ggtgccgaatttcacctcgatcttctcatacccgattctgccattgtcgtaagcaaggcc
accgatgttgcgcgcgaggcatactccgccttcgacggcaccggtttatccgaaacttta
aaggcagccggcacggaaaggatattcgtatgcggtctggcaaccgatttttgcgtaaaa
tctaccgccatggatgccagaaaattgggctacgatacatatgtcgtcctggacgcctct
cgaggcataagcgaagaaagcgttagggcaagccttgaagagatgaaagagacaggaata
aagatcgtcaaaagctttgaaatcgaatcgctataa

DBGET integrated database retrieval system