KEGG   Anaerobaculum mobile: Anamo_1092Help
Entry
Anamo_1092        CDS       T02151                                 

Definition
peptidase family protein
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
amo  Anaerobaculum mobile
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:amo00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Anamo_1092
Enzymes [BR:amo01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     Anamo_1092
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1064409..1065446)
Genome map
AA seq 345 aa AA seqDB search
MKGVKALYLKELSELDGVSGDEGRVRKFIEEKIKDKVDSLKVDALGNLIAFKKGTRSNRK
FVLAAHMDEVGFMVTNIEDDGTLSFGPVGGIDPRVVVGKHVRINGELPGVIGYKAIHLQK
KDELLASPKFENLRIHIGARSKEEASRKVELGDYISFATDFRQENSRATGKAFDDRAGCA
VLMEVIEQEQRYEDDLYFAFLVQEETGLRGSAVLFEQVCPDLALVIEGTTAGDDPGLPEH
QWATRLGDGPAITFMHRGYVVNKKIYESILQVAQKYDIKHQPKRRTAGGTDAARLAKTGG
GVPAGVISVPARYIHSPLSMIDLGDFENTVKLVSKILEEGEGFAR
NT seq 1038 nt NT seq  +upstreamnt  +downstreamnt
atgaaaggggtgaaggcgttgtacttaaaggagttatccgaacttgacggcgtctcggga
gacgaaggacgcgtcagaaagtttatagaagaaaagatcaaagacaaggtggacagctta
aaggtcgacgcactaggcaacctgatcgccttcaagaaggggaccaggtcgaacagaaag
ttcgtcctggctgcccacatggacgaggtcggcttcatggtgacaaacatagaggatgac
ggaactttgtcatttggccccgtagggggcatcgacccccgggtcgtcgttggaaagcac
gtcaggatcaatggagagctgcctggagtcatcggttacaaggccatacaccttcaaaag
aaggacgagcttctggcctcgcccaaattcgaaaaccttcgcatacatataggtgcaagg
tcaaaggaagaagcctcacgtaaagtggaattaggagactatatctcatttgcgacggat
ttcaggcaggaaaactccagggcaacgggcaaggccttcgatgacagggcaggttgcgcc
gtcttgatggaggtaatagaacaggaacaacgttacgaggacgacctgtactttgccttc
ctggtccaggaagagacgggccttcggggaagcgcggtgctttttgaacaagtttgccca
gatcttgccttggtcatcgaggggaccacagcaggagacgatccgggccttccggaacat
cagtgggcaactcgcctaggagacggccccgccatcaccttcatgcacaggggctacgtg
gtaaataaaaagatctacgaatcaatactgcaggtcgcccaaaaatacgacatcaaacac
cagccgaaaaggaggaccgcgggcggaacggacgctgcacgtttagccaagaccggcgga
ggagtgccggccggggtaatctccgttcctgctcgatatatccatagccctttgtccatg
attgacctgggagattttgaaaacacggtcaaactggtcagcaaaatcttagaagaagga
gagggttttgcaagatga

DBGET integrated database retrieval system