KEGG   Anaerobaculum mobile: Anamo_1092Help
Entry
Anamo_1092        CDS       T02151                                 

Definition
(GenBank) peptidase family protein
Organism
amo  Anaerobaculum mobile
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(1064409..1065446)
Genome map
AA seq 345 aa AA seqDB search
MKGVKALYLKELSELDGVSGDEGRVRKFIEEKIKDKVDSLKVDALGNLIAFKKGTRSNRK
FVLAAHMDEVGFMVTNIEDDGTLSFGPVGGIDPRVVVGKHVRINGELPGVIGYKAIHLQK
KDELLASPKFENLRIHIGARSKEEASRKVELGDYISFATDFRQENSRATGKAFDDRAGCA
VLMEVIEQEQRYEDDLYFAFLVQEETGLRGSAVLFEQVCPDLALVIEGTTAGDDPGLPEH
QWATRLGDGPAITFMHRGYVVNKKIYESILQVAQKYDIKHQPKRRTAGGTDAARLAKTGG
GVPAGVISVPARYIHSPLSMIDLGDFENTVKLVSKILEEGEGFAR
NT seq 1038 nt NT seq  +upstreamnt  +downstreamnt
atgaaaggggtgaaggcgttgtacttaaaggagttatccgaacttgacggcgtctcggga
gacgaaggacgcgtcagaaagtttatagaagaaaagatcaaagacaaggtggacagctta
aaggtcgacgcactaggcaacctgatcgccttcaagaaggggaccaggtcgaacagaaag
ttcgtcctggctgcccacatggacgaggtcggcttcatggtgacaaacatagaggatgac
ggaactttgtcatttggccccgtagggggcatcgacccccgggtcgtcgttggaaagcac
gtcaggatcaatggagagctgcctggagtcatcggttacaaggccatacaccttcaaaag
aaggacgagcttctggcctcgcccaaattcgaaaaccttcgcatacatataggtgcaagg
tcaaaggaagaagcctcacgtaaagtggaattaggagactatatctcatttgcgacggat
ttcaggcaggaaaactccagggcaacgggcaaggccttcgatgacagggcaggttgcgcc
gtcttgatggaggtaatagaacaggaacaacgttacgaggacgacctgtactttgccttc
ctggtccaggaagagacgggccttcggggaagcgcggtgctttttgaacaagtttgccca
gatcttgccttggtcatcgaggggaccacagcaggagacgatccgggccttccggaacat
cagtgggcaactcgcctaggagacggccccgccatcaccttcatgcacaggggctacgtg
gtaaataaaaagatctacgaatcaatactgcaggtcgcccaaaaatacgacatcaaacac
cagccgaaaaggaggaccgcgggcggaacggacgctgcacgtttagccaagaccggcgga
ggagtgccggccggggtaatctccgttcctgctcgatatatccatagccctttgtccatg
attgacctgggagattttgaaaacacggtcaaactggtcagcaaaatcttagaagaagga
gagggttttgcaagatga

DBGET integrated database retrieval system