KEGG   Acetomicrobium mobile: Anamo_1093Help
Entry
Anamo_1093        CDS       T02151                                 

Definition
(GenBank) peptidase family protein
  KO
K01179  endoglucanase [EC:3.2.1.4]
Organism
amo  Acetomicrobium mobile
Pathway
amo00500  Starch and sucrose metabolism
amo01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:amo00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Anamo_1093
Enzymes [BR:amo01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     Anamo_1093
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M42 Peptidase_M20
Motif
Other DBs
NCBI-ProteinID: AFM21717
UniProt: I4BWR0
Position
complement(1065446..1066453)
Genome map
AA seq 335 aa AA seqDB search
MDTVSLLKCLSSADSPSGYEDEALKVIEENIKPYVDSVRKHKMNALIAVKNGQNGKKLGI
FAHADEIGFVVAKLEERGFLRVEPIGGIDPKVVISQRIKIFTKQGVATGVVGFLPPHLQK
DDQKDKVPDYNDIYVDVSCSPLSEAVSVGDICVIEGRCASLGDRFSGKALDNRASCAALI
LAASKLEIIKNRADVYFIFSSQEEIAGPGAVSVAYELGLDEAIVVDVTHGNEHVPQMPPI
KISEGPVLAVGPVINREFYKALCDVAKRHGVRTQIEPTPGRSHTDTDEVQLTRSGIKTAL
VSIPLMYMHTPVELVDPRDVEETARLLALASTVNL
NT seq 1008 nt NT seq  +upstreamnt  +downstreamnt
ttggataccgtttctttgcttaaatgtctttcgagcgcggacagtccctcgggctatgag
gacgaagccttaaaggtcatcgaagaaaacatcaaaccctacgtcgattccgtaagaaag
cacaagatgaacgcgcttatagccgtaaaaaatgggcaaaacggcaaaaagcttgggata
tttgcccatgctgacgagatcgggttcgtcgtcgcaaagcttgaagaaagaggttttttg
agggtcgagccaatcggcggcatagatccgaaggtggtcatctcccaaaggataaagata
ttcaccaagcaaggtgtcgccacaggagttgtaggctttcttcctcctcacctccaaaaa
gatgatcaaaaagataaggtccccgattacaacgacatttacgtcgatgtatcctgcagc
cccttaagcgaagccgtaagcgtaggagacatttgcgtcatcgaaggaaggtgtgcctct
ttaggcgacaggttctcgggtaaggccttagacaacagggcaagctgtgctgccctcatc
ttggccgccagcaagcttgagattataaaaaacagggctgacgtttatttcatcttttca
agccaggaggagatcgcaggcccgggagcagtctccgttgcgtacgagcttgggttggac
gaggccatagtggtagacgtcacccacggcaatgaacacgtgccgcagatgcccccgatt
aagatctcggaaggtccagtattggcagtcgggcccgtcataaacagggagttttacaag
gccttatgtgacgtggcaaaacgccacggcgtaaggacgcagatcgagccgacgcccggg
aggtctcataccgacacggacgaggtacagcttacgaggtcgggtataaagacggcgctg
gtctccataccgctcatgtacatgcacacgcccgtagagttggtcgatccccgtgacgtg
gaagagaccgcacgcctgctggcattggcaagcaccgtgaacctttga

DBGET integrated database retrieval system