KEGG   Anaerobaculum mobile: Anamo_1252Help
Entry
Anamo_1252        CDS       T02151                                 

Definition
6-phosphofructokinase
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
amo  Anaerobaculum mobile
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Brite
KEGG Orthology (KO) [BR:amo00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Anamo_1252
   01230 Biosynthesis of amino acids
    Anamo_1252
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Anamo_1252
   00030 Pentose phosphate pathway
    Anamo_1252
   00051 Fructose and mannose metabolism
    Anamo_1252
   00052 Galactose metabolism
    Anamo_1252
  Energy metabolism
   00680 Methane metabolism
    Anamo_1252
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    Anamo_1252
Enzymes [BR:amo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Anamo_1252
Protein phosphatases and associated proteins [BR:amo01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Anamo_1252
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1227077..1228339
Genome map
AA seq 420 aa AA seqDB search
MNFKGNTLALICGGGPAPGINNVIASVTIEARNNGWDVLGICDGFSRLATANKRVIPLTI
DMVSRIHTEGGSILRTSRFNPTKSEQTLKTVVENLVDLGVTHIVTIGGDDTAYAAYKLSE
FAREKLGLNIHFVHVPKTIDNDLPLPEGLPTFGFETARALGAELVMNLMEDAKTMGRWFL
VVTMGRSSGHLALGIGKSASATLTVIPEEFEGDTICLKHIIDIMSGAIIKRLALEKDHGV
IVAAEGLISKIPSQELAAIDSIEKDDYGHVRYAEINFSDVLKKQLNGELKKMGIPISVQN
KEIGYEVRCAPPNPFDVEYTRNLGYGAFEFLAGGGTNAVITIQNNQLTPIPFDEIVDPAT
GKMRIRLVDTNSLQYRIAKEYMIRLERGDFASEFLLNKMSRIANMTPQQFVEKYGYVAGL
NT seq 1263 nt NT seq  +upstreamnt  +downstreamnt
atgaactttaagggcaacacattggccctcatatgcggcggagggcccgcgccggggata
aacaacgtaatagcttccgtcaccatagaggcgcgaaacaacggctgggacgtgcttggc
atctgcgacggcttttcccgcctggcaacggccaataaaagggtcatcccccttaccata
gacatggtaagccgcatccacaccgagggaggaagtatactgcgcacgtcgcgctttaac
cccacaaaaagcgaacagacgctaaagacagtggtcgaaaacttagtcgatcttggtgtc
acccatatagtcaccatcggcggggacgatacggcctacgccgcctacaagctgtctgag
tttgccagggaaaagctcggcttaaacatccatttcgtccatgtcccaaagaccatagat
aacgacctgcctttgcccgagggacttcccacctttggctttgagacggccagggcattg
ggtgcggaactggtgatgaacctcatggaggatgcaaagaccatgggccgctggtttctg
gtcgtaacgatgggacgttccagcgggcatttggccttaggcatcggcaaaagcgccagc
gccacgctcaccgtaatacccgaggagttcgagggagacaccatatgccttaagcacatc
atcgatataatgagcggcgccatcataaaaaggcttgccctggaaaaggaccatggcgtg
atagtggcggccgaagggctgatctccaaaatcccctctcaggagctggcggccatagat
tccattgaaaaggacgactacgggcacgtccgctatgccgagatcaacttctccgacgtc
ttaaaaaagcagctcaacggcgagctaaagaagatgggcatccccatatcggtccaaaac
aaggagatcggatacgaagtcagatgcgctcccccaaatcccttcgacgtggagtacacc
cgaaacctgggttacggtgccttcgagtttctggcaggcggcggcaccaatgccgtgatc
accatacaaaacaaccaactgacgcccatacccttcgatgaaatagtagaccccgccacg
ggcaagatgaggatcaggctcgtggatacaaattcgctgcaatacagaattgccaaggaa
tacatgatccgcctggaaaggggcgacttcgcatcggaattcctcttaaacaagatgtcg
cgcatcgccaacatgacgccgcagcagttcgtggaaaaatacggatatgtggctgggctg
taa

DBGET integrated database retrieval system