KEGG   Anaerobaculum mobile: Anamo_1315Help
Entry
Anamo_1315        CDS       T02151                                 

Definition
peptidase family protein
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
amo  Anaerobaculum mobile
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:amo00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1294500..1295582)
Genome map
AA seq 360 aa AA seqDB search
MKERLKERLKDLTSLCGVSGDEREVVRYLRDAFTPIADSVEIDSWGNIYVIKRGSADGPV
LMVSAHSDEIGMVVKSIRDDGFICFDRVGGVNDVLLPGRKVLIRGKIPGVIGIKAGHLQK
EEEKRQVRSIRECYIDVGASSKKDVEAMGIKIGHRITFQSDFTEMYNPDLVSTKSIDNRI
SCAIILELFFNLNHADFPGTLCGVVCVQEEIGLRGAAMAVKRVKPDWAVVLDTIPCGDTP
DINFQSELPIKLGHGPVCPLIDGIAGGFANNVVHPKIAECIERHSQKTGVNVQYVTLSGE
SYTTDATNVSLAGVPTGLLTTPRRYSHSPVELVNMNDAAGLLNILNSMVMSNGEIDFTYF
NT seq 1083 nt NT seq  +upstreamnt  +downstreamnt
gtgaaggaaaggcttaaagaaagactcaaggatttgacgtccctatgtggcgtgtcgggt
gacgagcgcgaagtagtgaggtatttaagggatgctttcacgccaattgcagattctgtt
gagatagatagctggggtaatatttacgtcataaaaagaggcagcgcagatgggcctgta
ttgatggtgtcagcacattccgatgagatcgggatggtggtaaagagcattcgcgatgat
ggattcatatgttttgacagggtaggcggggttaatgatgttttactcccaggaagaaag
gtattaataaggggcaagatacctggagtgataggaattaaagcaggacaccttcaaaag
gaggaagaaaaaaggcaggttcggtccattagggaatgctacatagatgttggggcttct
tctaaaaaggatgtggaagcgatgggcatcaagatcggccatcgtattacgttccaaagc
gattttaccgaaatgtataatccagacctcgtatcgacaaaatcgatagacaatcgcata
agctgtgccattattttagaattgttcttcaatctcaatcatgcagactttccgggaacc
ctttgtggggtcgtctgcgtacaagaggaaattggccttcgaggtgccgcaatggcggtg
aaaagggtaaagcccgattgggctgttgtgctggatactatcccttgtggtgatacgcct
gatatcaatttccagtcagagcttccgattaaactggggcatggcccggtatgtccgctc
atcgacggtatagcaggaggatttgccaacaacgtagtccacccgaaaattgcagaatgc
atcgaaaggcattctcaaaaaacaggggtaaacgtccaatatgtgactttaagcggggag
tcttacactaccgatgcaacgaatgtttccttagcaggtgttcctacagggttgttgact
acgccgcggcgatattctcattctcccgttgagcttgttaatatgaatgatgccgctggg
ttattgaatattttaaatagcatggtaatgtctaacggagaaatagattttacttatttc
tag

DBGET integrated database retrieval system