KEGG   Anaerobaculum mobile: Anamo_1395Help
Entry
Anamo_1395        CDS       T02151                                 

Definition
(GenBank) 2-oxoacid:ferredoxin oxidoreductase, beta subunit
  KO
K19071  
oxalate oxidoreductase subunit beta [EC:1.2.7.10]
Organism
amo  Anaerobaculum mobile
Brite
Enzymes [BR:amo01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.10  oxalate oxidoreductase
     Anamo_1395
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(1385581..1386519)
Genome map
AA seq 312 aa AA seqDB search
MMLETIKTLRDMPQEEYYVPGHRTCAGCGPALVYRLVAKAAGPNTIFVGPTGCMYVANTS
YGCGPWAVPWIHAQITNGGGVASGIEAAYKAMMRKGKYTGERPHVIVMAGDGGSTDIGLQ
ALSGMIYRGHDVLFICYDNESYANTGIQTSPTTPWGAVTTFTPSGPAVPEGKRLWPKDNA
QMIAHGHPELKYLATASPAFPVDLFNKVRKGLNAEGPAYLHIQAPCPKGWQFPSSKTIEM
AKLALDTGMFQLYELENGKYKISYMPKQRKPVDEYLKLQGRFKHLKPEHIEKIQNFVDQK
VKAIEIEIAALS
NT seq 939 nt NT seq  +upstreamnt  +downstreamnt
atgatgttagagaccataaagacccttcgtgatatgcctcaagaagaatattacgttcct
ggtcacaggacatgtgccggatgtggccctgctttggtgtatagattggtggcaaaggct
gcaggcccgaacaccattttcgtcggtcccacaggttgcatgtacgttgctaacacgagc
tacggctgtggtccgtgggctgtgccttggattcatgctcagatcacaaacggcggtggc
gtggcctccggcatagaggctgcctacaaggcaatgatgagaaagggaaaatatacaggc
gagcgcccacatgtcatagtgatggccggtgacggtggttctacggatattgggctacag
gctttatcagggatgatctatcgcggacacgacgtgcttttcatatgctacgacaatgaa
tcttacgccaacacgggcattcagacttcgccgaccactccttggggagcggttaccacc
tttacgccctccggccctgctgttcctgaaggcaaaaggttgtggccgaaggataacgcc
cagatgatagctcacggacatccagagctgaaatatttggcaacggcctctccggcgttt
cccgtggatcttttcaacaaggtaagaaaaggcctaaacgcagagggaccggcatatctc
catattcaagctccttgcccaaagggatggcagttcccttcaagcaagacgatagagatg
gcaaaacttgccctagatacaggcatgtttcagctgtatgaacttgaaaacggcaagtac
aaaatatcctacatgccaaaacagcgcaaaccggtggatgagtatctcaagttgcaggga
aggtttaaacatctgaaacctgagcacatcgaaaagattcaaaacttcgtcgatcagaag
gtcaaggcaatagagatagagatagctgctctttcgtaa

DBGET integrated database retrieval system