KEGG   Anaerobaculum mobile: Anamo_1397Help
Entry
Anamo_1397        CDS       T02151                                 

Definition
(RefSeq) pyruvate ferredoxin oxidoreductase, gamma subunit, pyruvate ferredoxin oxidoreductase, delta subunit (EC:1.2.7.1)
  KO
K19072  
oxalate oxidoreductase subunit delta [EC:1.2.7.10]
Organism
amo  Anaerobaculum mobile
Brite
Enzymes [BR:amo01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.10  oxalate oxidoreductase
     Anamo_1397
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1387731..1388690)
Genome map
AA seq 319 aa AA seqDB search
MSLDAKKLFEEPSLIQITTWARGVLQNKDARDVVFALANAGSKEGKYVQAWENYVDLPDR
VGVPVRAYARVSEEPILSKYIYENENPDVVVLTEEALVKGNDVLAGMKPGGVLIVNTKRD
PQYILKFLKDTTYLGTIGCVDATGVAGYVQTLSGAEGATDASGIGVGAGAVLAGAVVKAK
PFVKPESVFSSVKNEQACRYGYNEVHLMTVNTTFPAFVPAPKKQLGVDDLPFAGTVPSVN
KENEKRVTGNWRSERPVWSKERCTSCLLCWASCPDAVITYKTPEAMEFNNLKYCKGCGLC
AAVCPTKAITMVPELDFED
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atgagtcttgatgcaaagaagttgtttgaagagcctagtctgattcagatcacgacttgg
gcgcgcggtgtcctgcaaaacaaggatgccagggatgttgtctttgcgttagctaacgcc
ggatccaaagagggcaagtatgttcaggcatgggaaaattacgtcgatcttccggacagg
gtgggcgttcctgtgcgtgcttatgctcgagtgagcgaagagcccattttaagcaagtac
atatatgagaacgaaaatccggatgtggtagtccttacggaagaggcgttggtaaaggga
aatgacgtattggcagggatgaagccgggtggtgtcttgatagtaaacaccaagagggat
ccacagtatatactgaagttcttgaaggacactacctatcttggaaccatagggtgcgtc
gatgctacgggagttgccggttacgtccagacgctttcgggagcagaaggagctacggac
gcatcaggtataggcgtaggcgcaggagcggttttggcaggagcagttgtaaaggctaaa
ccgttcgttaagcccgaaagcgtattctcctcggtgaagaacgagcaagcctgcagatat
ggctacaacgaggtccacctgatgaccgtaaatactacttttcctgcctttgtccctgca
cctaaaaaacaactaggggtggatgaccttccctttgccggcacagtgccgtccgtgaac
aaggaaaacgaaaagagggtaacgggcaactggagatccgaaaggcccgtttggtcaaag
gaacgttgcaccagctgtttgctgtgttgggccagctgtcccgatgctgtcataacctac
aagactcccgaggccatggaatttaacaacctgaaatactgtaagggttgtggcctttgt
gcggccgtgtgtccgacgaaggctataaccatggtaccagagttggattttgaggattag

DBGET integrated database retrieval system