KEGG   Anaerobaculum mobile: Anamo_1467Help
Entry
Anamo_1467        CDS       T02151                                 

Definition
aldehyde:ferredoxin oxidoreductase
Orthology
K03738  
aldehyde:ferredoxin oxidoreductase [EC:1.2.7.5]
Organism
amo  Anaerobaculum mobile
Pathway
Pentose phosphate pathway
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:amo01200]
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:amo00030]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1454692..1456860
Genome map
AA seq 722 aa AA seqDB search
MDKMRLLARWEYKPVNIYRGYAGRTLYVNISNFSFEERPVSEDMKEKFIGGRGFGLKLLW
DAVKDTTKWNDPENEIVISGGPLCGITQYPGSGKCYTVFISPLTEQTYDSNAGGYFGPLL
KFSGWDALEIQGKADRDIVVFIDGDNNRVEIYESPFEEVNAVTVTEALHEYFAEDEEDKR
NISVVSTGKGAENSYWGCLNMSFYDLRRKTPRLKQAGRGGGGTVFRDKKLAAIVVKKRGI
GPSSNNPADLTTLQRVGLKLHKEIRDLDDQQNKMRKVGTPHLNEIMNEYHLLPVHNYKFG
QHKDASKIHSKVFERIFTQGIPDGCWYGCSMACAKAADKFELKTGPLKGRKVTVDGPEYE
TCAGLGSNIGVFDPEWIIEANFYADHYGLDTISLGTGIAFVCECYELGFLNKEITNGLEL
KFGAKDDIMELIHRMGRGDDEFARIVGLGIHRMKKIFAEKYGAPSDVLENIGMEGQGLEV
SEYVPKESVAQWGGYFLTLKGPQHDEAWLIFMDRVNKQLPTFEDKAEALHYFPNFRLWFS
LVGLCKLPWNDIEPADNAIKYKGIEAAKVPEHVQNYVDLFNAVTGKKITKEELIIQSERV
YNFQRVFQLRLGRGTRKDHNIPLRAIGPVFPDEWEARSDYYDNELKAAGIDPENLSTEEK
IKKLQNYRLSQWEQLVDAVYRRRGWNKNGIPTIETLRRLGIDYPEVVEVVKRHLKPEDEW
ES
NT seq 2169 nt NT seq  +upstreamnt  +downstreamnt
atggacaagatgaggctcctcgcaagatgggaatacaaacctgtgaatatttatagagga
tacgccggaaggacgctttacgttaacatcagcaattttagcttcgaggaaagacccgta
tctgaagatatgaaggaaaagttcataggaggaaggggctttggccttaagctgctttgg
gacgctgtgaaggatacgacaaaatggaacgatcccgaaaatgaaattgtaatatcaggg
ggacctttgtgtggaataacccagtaccctggttcaggcaaatgttatacagtgtttatc
tcaccattaacggagcaaacatacgatagcaatgctggcggttactttggcccgctactt
aaattctcggggtgggatgcactggaaatccagggaaaagccgatcgcgacatcgtcgtc
ttcatcgatggggataacaatagagttgagatttatgaatcgccctttgaagaagtaaat
gccgttacggtgaccgaagccttgcatgaatatttcgcggaagacgaggaggataagcga
aacatatcggtggtgtctaccggcaagggcgcagaaaacagttactggggatgtcttaac
atgagcttctacgatctccgtcgaaagacacctcgtctaaaacaagccggaagaggcgga
ggcggcacggtctttcgcgacaaaaaattagcagctatcgtggtcaagaaaagaggcatt
gggccctcgagcaataacccagcggacctaaccacacttcaacgggttggcctaaaactc
cacaaggagattcgagaccttgatgaccagcaaaacaagatgcgcaaggttggtactcca
catttaaacgagataatgaacgaatatcacctcctcccagtgcataactacaagttcggc
caacacaaggacgcctcaaagatccactcaaaggtctttgaacggatattcacccaagga
atccccgatggatgttggtatggatgctccatggcttgcgctaaagctgccgataaattc
gagctcaaaaccggccccctaaagggcaggaaagttacggtagatggacctgagtatgag
acctgtgccggtttaggttccaatattggcgttttcgatcccgaatggatcatcgaggcc
aacttctacgccgatcattacggactggataccatatccttgggaacgggcatagctttc
gtgtgcgaatgctacgagcttggtttccttaacaaggaaatcactaacggacttgagttg
aaattcggggcaaaggatgacattatggagctaatacacaggatggggcgtggcgacgac
gagtttgcccgcattgttggccttggtatccaccggatgaaaaagatatttgccgaaaag
tatggagctcctagcgatgttctcgaaaacataggcatggaaggtcaaggcctggaggta
tcggaatatgtaccaaaggaatctgtcgctcaatggggcggatatttcctcacgctaaaa
ggaccgcaacacgacgaggcctggctgatcttcatggacagagtgaacaagcaattaccc
acgttcgaggataaggccgaggctttgcattacttccccaacttcaggctatggttttct
ttggtgggcttgtgcaaactaccatggaacgacattgagccagccgacaacgccatcaaa
tataaaggcattgaagctgccaaggtgcctgaacacgtccaaaattacgtagaccttttt
aacgccgtgaccggaaagaaaatcaccaaggaagagctgataatacaatccgaaagggtt
tacaacttccagcgggtctttcagttaaggctaggcagggggactcgaaaagaccacaac
atccccttgcgggcaatagggccggtgtttcccgatgaatgggaagcaagaagcgactac
tatgacaatgagctgaaagctgcaggcatcgaccccgaaaatctctcgacggaggaaaag
atcaaaaagctgcaaaattaccgtttgtcccaatgggagcagctcgtcgatgccgtatac
aggcgcagagggtggaacaaaaacggcataccaacaatcgagacgttaaggcgtttgggg
atcgactatccggaagttgttgaggtagtaaaaagacaccttaagcccgaggatgaatgg
gaaagttaa

DBGET integrated database retrieval system