KEGG   Anaerobaculum mobile: Anamo_1467Help
Entry
Anamo_1467        CDS       T02151                                 

Definition
aldehyde:ferredoxin oxidoreductase
Orthology
K03738  
aldehyde:ferredoxin oxidoreductase [EC:1.2.7.5]
Organism
amo  Anaerobaculum mobile
Pathway
Pentose phosphate pathway
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:amo00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Anamo_1467
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Anamo_1467
Enzymes [BR:amo01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.5  aldehyde ferredoxin oxidoreductase
     Anamo_1467
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1454692..1456860
Genome map
AA seq 722 aa AA seqDB search
MDKMRLLARWEYKPVNIYRGYAGRTLYVNISNFSFEERPVSEDMKEKFIGGRGFGLKLLW
DAVKDTTKWNDPENEIVISGGPLCGITQYPGSGKCYTVFISPLTEQTYDSNAGGYFGPLL
KFSGWDALEIQGKADRDIVVFIDGDNNRVEIYESPFEEVNAVTVTEALHEYFAEDEEDKR
NISVVSTGKGAENSYWGCLNMSFYDLRRKTPRLKQAGRGGGGTVFRDKKLAAIVVKKRGI
GPSSNNPADLTTLQRVGLKLHKEIRDLDDQQNKMRKVGTPHLNEIMNEYHLLPVHNYKFG
QHKDASKIHSKVFERIFTQGIPDGCWYGCSMACAKAADKFELKTGPLKGRKVTVDGPEYE
TCAGLGSNIGVFDPEWIIEANFYADHYGLDTISLGTGIAFVCECYELGFLNKEITNGLEL
KFGAKDDIMELIHRMGRGDDEFARIVGLGIHRMKKIFAEKYGAPSDVLENIGMEGQGLEV
SEYVPKESVAQWGGYFLTLKGPQHDEAWLIFMDRVNKQLPTFEDKAEALHYFPNFRLWFS
LVGLCKLPWNDIEPADNAIKYKGIEAAKVPEHVQNYVDLFNAVTGKKITKEELIIQSERV
YNFQRVFQLRLGRGTRKDHNIPLRAIGPVFPDEWEARSDYYDNELKAAGIDPENLSTEEK
IKKLQNYRLSQWEQLVDAVYRRRGWNKNGIPTIETLRRLGIDYPEVVEVVKRHLKPEDEW
ES
NT seq 2169 nt NT seq  +upstreamnt  +downstreamnt
atggacaagatgaggctcctcgcaagatgggaatacaaacctgtgaatatttatagagga
tacgccggaaggacgctttacgttaacatcagcaattttagcttcgaggaaagacccgta
tctgaagatatgaaggaaaagttcataggaggaaggggctttggccttaagctgctttgg
gacgctgtgaaggatacgacaaaatggaacgatcccgaaaatgaaattgtaatatcaggg
ggacctttgtgtggaataacccagtaccctggttcaggcaaatgttatacagtgtttatc
tcaccattaacggagcaaacatacgatagcaatgctggcggttactttggcccgctactt
aaattctcggggtgggatgcactggaaatccagggaaaagccgatcgcgacatcgtcgtc
ttcatcgatggggataacaatagagttgagatttatgaatcgccctttgaagaagtaaat
gccgttacggtgaccgaagccttgcatgaatatttcgcggaagacgaggaggataagcga
aacatatcggtggtgtctaccggcaagggcgcagaaaacagttactggggatgtcttaac
atgagcttctacgatctccgtcgaaagacacctcgtctaaaacaagccggaagaggcgga
ggcggcacggtctttcgcgacaaaaaattagcagctatcgtggtcaagaaaagaggcatt
gggccctcgagcaataacccagcggacctaaccacacttcaacgggttggcctaaaactc
cacaaggagattcgagaccttgatgaccagcaaaacaagatgcgcaaggttggtactcca
catttaaacgagataatgaacgaatatcacctcctcccagtgcataactacaagttcggc
caacacaaggacgcctcaaagatccactcaaaggtctttgaacggatattcacccaagga
atccccgatggatgttggtatggatgctccatggcttgcgctaaagctgccgataaattc
gagctcaaaaccggccccctaaagggcaggaaagttacggtagatggacctgagtatgag
acctgtgccggtttaggttccaatattggcgttttcgatcccgaatggatcatcgaggcc
aacttctacgccgatcattacggactggataccatatccttgggaacgggcatagctttc
gtgtgcgaatgctacgagcttggtttccttaacaaggaaatcactaacggacttgagttg
aaattcggggcaaaggatgacattatggagctaatacacaggatggggcgtggcgacgac
gagtttgcccgcattgttggccttggtatccaccggatgaaaaagatatttgccgaaaag
tatggagctcctagcgatgttctcgaaaacataggcatggaaggtcaaggcctggaggta
tcggaatatgtaccaaaggaatctgtcgctcaatggggcggatatttcctcacgctaaaa
ggaccgcaacacgacgaggcctggctgatcttcatggacagagtgaacaagcaattaccc
acgttcgaggataaggccgaggctttgcattacttccccaacttcaggctatggttttct
ttggtgggcttgtgcaaactaccatggaacgacattgagccagccgacaacgccatcaaa
tataaaggcattgaagctgccaaggtgcctgaacacgtccaaaattacgtagaccttttt
aacgccgtgaccggaaagaaaatcaccaaggaagagctgataatacaatccgaaagggtt
tacaacttccagcgggtctttcagttaaggctaggcagggggactcgaaaagaccacaac
atccccttgcgggcaatagggccggtgtttcccgatgaatgggaagcaagaagcgactac
tatgacaatgagctgaaagctgcaggcatcgaccccgaaaatctctcgacggaggaaaag
atcaaaaagctgcaaaattaccgtttgtcccaatgggagcagctcgtcgatgccgtatac
aggcgcagagggtggaacaaaaacggcataccaacaatcgagacgttaaggcgtttgggg
atcgactatccggaagttgttgaggtagtaaaaagacaccttaagcccgaggatgaatgg
gaaagttaa

DBGET integrated database retrieval system