KEGG   Anaerobaculum mobile: Anamo_1732Help
Entry
Anamo_1732        CDS       T02151                                 

Definition
glycerol kinase (EC:2.7.1.30)
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
amo  Anaerobaculum mobile
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:amo00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    Anamo_1732
Enzymes [BR:amo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     Anamo_1732
Exosome [BR:amo04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Anamo_1732
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1743289..1744800)
Genome map
AA seq 503 aa AA seqDB search
MAKKYVAAIDQGTTSTRCMIFDREGNPISSSQMEHEQIYPHPGWVEHDPMEIWSRTQDVI
RGALEKGNVDPNDIAAIGITNQRETTVVWDKNTGKPVYNAIVWQCMRTQDFCLEWEKEPG
ANEKVNQKTGLVISTYFSGPKIKWILDNVPGARERAQKGELLFGNIDTWVIWNLTGGPNG
GVHVTDVSNASRTMLMNIKTLQWDEEMLNFLGIPKSMLPEIKPSSHIYGYTVPNGPFRAS
IPISGDLGDQQAAVFGQVCFNVGEAKNTYGTGNFMLLNIGKTPSLSKSGLLTTVAYGLKE
GEAVYALEGSMAITGAAIQWLRDNLRLFDDAADSEWFASKVKDTGGIYFVPAFSGLFAPY
WDMRARGCIVGLTRYIRKEHLIRATLECICYQTLDVQRAMEADSGVPLTELKVDGGAVRN
NLLMQLQADLLGVPVVRPKVNETTALGAAYAAGLATGFWTSLDELKQNWKVDKRFEPTMS
KETRDEMYRGWKKAIERAKGWID
NT seq 1512 nt NT seq  +upstreamnt  +downstreamnt
atggcaaagaaatatgttgctgctattgatcagggaactaccagtacgaggtgtatgata
ttcgacagggaaggcaatccgatatccagcagccagatggagcatgaacaaatttaccct
catcctggctgggtagaacacgatcccatggagatctggtcgcgtacgcaagacgtaatt
agaggggcattggagaaaggcaatgtagatcccaatgacattgcggcaatcggcataacg
aaccaaagggaaacgacggtagtatgggataaaaatacaggtaaacccgtctataatgca
atcgtttggcaatgcatgaggactcaggatttctgtctggaatgggagaaagagccaggc
gcgaacgaaaaggtcaatcaaaagactggccttgtgataagcacctatttctcgggtccc
aagatcaagtggatcttagacaacgttcccggcgccagggaaagggcccaaaagggagag
ctgcttttcggaaacatagatacatgggtaatttggaatctaacgggcggtccgaacggc
ggggttcatgtaaccgatgtcagcaatgcgtccaggactatgctcatgaatatcaaaacg
ctgcaatgggacgaggaaatgctgaatttcttgggcattccgaaatccatgttaccagag
atcaaaccaagcagccatatttacggctatactgtccctaacggaccattcagggcgagc
atccccatttcgggagatcttggagaccagcaggcagcggtctttggtcaagtatgcttc
aacgttggcgaggcaaagaacacctacggcacgggaaacttcatgttgctaaatataggc
aagactccaagcctttccaagagcggtctgcttacgacagttgcttatggccttaaagag
ggagaagctgtttatgccttagagggatcgatggccattacgggagctgcgatccagtgg
ctgcgtgacaacctgagactttttgatgatgctgccgattcggaatggtttgccagcaag
gtcaaagatactggcgggatatatttcgtcccggccttctccggattgtttgcaccttat
tgggatatgagagctagaggttgtatagtgggattgacgagatacattcgaaaagagcat
ttgatcagggctaccctggaatgcatttgctatcagaccttggacgtccaaagggcaatg
gaagccgattccggagtgcccctcacggaacttaaagtggatggcggtgctgtacgaaat
aacctcctcatgcagttgcaggccgacctcttgggtgttccggtcgtgcgtccaaaggta
aatgagactacggcgctgggtgctgcttatgctgctggtcttgctacaggtttttggacg
agcttagacgagctaaagcaaaattggaaagttgataagcggtttgagccaaccatgagc
aaggaaacgagagatgaaatgtacagaggctggaagaaggcgattgaaagagctaaggga
tggatagattag

DBGET integrated database retrieval system