KEGG   Anaerobaculum mobile: Anamo_1751Help
Entry
Anamo_1751        CDS       T02151                                 

Definition
4-alpha-glucanotransferase (EC:2.4.1.25)
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
amo  Anaerobaculum mobile
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:amo00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Anamo_1751
Enzymes [BR:amo01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     Anamo_1751
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1762084..1763568)
Genome map
AA seq 494 aa AA seqDB search
MIPVDGRKSGVLLHITSLPSPWGVGDMGSQSYRFIDLLKECNQSVWQILPLNPTEEIYGF
SPYSSVSAFAGNVMLISPMAMVEEGFLTEGDLPPSFNGLTANFRDAINIRQDLLYKGYCK
FTPDDDFRRFGEENSWWLEDYALYKALKSHYKLPWYEWPDELKSRQPQAIEMARKKFANE
IMAEKFAQYIFYRQWDRLHLYAKSKGISVFGDMPLYLAHDSADVWANREMFCLDERGMPT
HVAGVPPDYFSVTGQYWGNPLYNWDAMEKHGFEWWIRRLAHAFRLYDMVRIDHFRGLVAY
WAIPSQESTAVNGRWVKGPANKLFNAIINRLGNVPIVAEDLGQITQDVRQLMDAFHIPGM
RVILFGLDNPKQNLHAPFYYTENCVAYTGTQDNNTALGWFLEEASSAAVKNLKLFLGRKT
EANCVSRDMVRLVELSVAKLVIIPFQDILGLGPEARMNRPASKDGNWQWRMHEDMMRAPV
LKWFKGITMFADRG
NT seq 1485 nt NT seq  +upstreamnt  +downstreamnt
gtgattcccgtagacggaagaaaaagcggtgtattgctccatatcacatccttgccctcc
ccttggggcgtgggtgacatgggatctcaaagttatcgcttcatcgatttgcttaaagag
tgcaatcaatcagtttggcagattttacccttaaatcccacggaggaaatttatggtttt
tccccctatagttcggtttccgcgtttgcgggaaacgttatgctgataagcccaatggcg
atggttgaggagggttttttgacagagggagatcttcctcctagttttaatggccttacc
gctaatttcagggatgcaataaatatccgccaagatctgctgtataaggggtactgcaag
tttactcccgacgatgattttcgacgttttggcgaagaaaattcctggtggctggaagat
tatgctttatataaggcacttaaatcacattacaaattgccatggtacgaatggccggat
gagctaaaaagcaggcaaccgcaagccatagaaatggcacgcaagaagtttgccaatgaa
ataatggctgaaaaatttgctcagtacatcttttaccggcagtgggatagattgcatttg
tatgcgaaatcaaaggggattagcgtgtttggggatatgcctctatatttggctcacgat
agcgccgacgtgtgggcgaaccgggagatgttttgtctcgatgaaagaggcatgccaacc
catgtagctggcgttcctccagattactttagcgtaacaggacaatattggggtaatccc
ctatataactgggatgcaatggagaagcatggattcgagtggtggattaggcgattggct
catgccttcagattgtacgacatggttaggatagatcattttagggggttagtggcttac
tgggcaatcccgtcacaggaatcaacggccgttaacggaagatgggtgaagggccctgcc
aataagttgttcaatgctataataaatcgtttaggcaatgttccgatagtagcggaggac
ttagggcagataactcaggatgttcgtcaacttatggacgccttccatatacctggcatg
agggtcattctatttgggctggacaacccgaaacagaacttacacgcaccgttttattac
actgagaattgcgttgcctataccgggactcaggataataatactgcgttgggatggttt
ctggaagaagcctcctcagcggccgtaaaaaacctgaaacttttcttaggacgtaaaacg
gaggcaaactgtgtgtctcgtgacatggttcgcttagttgagctgtccgtagccaagttg
gtgattatcccctttcaagatatactggggcttgggcctgaagcacgaatgaacaggccg
gccagcaaggatggtaattggcaatggcgtatgcatgaggatatgatgagagcaccggtg
ttaaaatggtttaaaggcattacgatgttcgcagataggggctag

DBGET integrated database retrieval system