KEGG   Anaerobaculum mobile: Anamo_1810Help
Entry
Anamo_1810        CDS       T02151                                 

Definition
(GenBank) tryptophan synthase, beta subunit
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
amo  Anaerobaculum mobile
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:amo00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Anamo_1810
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Anamo_1810
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Anamo_1810
Enzymes [BR:amo01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Anamo_1810
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1829154..1830338
Genome map
AA seq 394 aa AA seqDB search
MKVKGYFGKFGGRFVPETLMPALEELEKAYLEAKDDPSFISQYNYLLKEYSGRPTPLYYA
DRLSTCLGGIKLYLKREDLNHTGAHKINNVIGQILLAMRMGKKRIIAETGAGQHGLATAT
AAAKFGLECHIYMGVEDIHRQALNVYKMRTLGAEVIPVASGSMTLKDATNEAIRDWVTNV
STTHYVIGSVVGPHPYPMMVRDFQRIIGDETKEQILEKEGRLPDMLVACVGGGSNSMGMF
YPFVDDKEVKMVGVEAAVYGIETGKHAAALTGGSIGVLHGSKSYILQDEYGQIVPAVSIS
AGLDYPGVGPEHSFYHETGRVYYTYASDDEAIEAFKLLCETEGIIPALESAHALAYLMRE
YRNIKPGSLVVLCLSGRGDKDMEALKGKLFKEEE
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
ttgaaagttaagggatattttggcaaattcggcgggagattcgtgcccgaaactttaatg
ccagcactggaagaactggaaaaggcttacctggaggcgaaagacgacccgtcctttata
tcacagtataactatttattgaaggaatactcaggaagaccgacgccgctttactatgcc
gatcgcctttccacctgccttgggggcataaagctttacctgaagcgtgaggacttaaat
catactggcgcacataagatcaataatgtgatcggccagatactccttgccatgcgcatg
ggcaaaaagaggatcatagccgagactggggcgggccagcacggtttagcgaccgccact
gctgccgccaagtttggattggaatgccacatctacatgggagtcgaggacatacacagg
caggccttaaacgtatataagatgaggacgctgggggcagaggtaatacccgtcgcctca
ggcagcatgacgcttaaggatgccaccaatgaggccataagggactgggtgaccaacgta
tctaccacccattacgtgataggctcggtcgttggcccccatccttacccaatgatggtg
cgcgatttccagcgcatcataggcgatgagacgaaggaacaaatccttgagaaggaaggc
cgtcttcccgacatgttggtggcctgcgtgggcggagggagcaactccatgggcatgttt
tatcccttcgttgacgacaaagaggtgaagatggtgggcgtagaggcagcagtatacggc
atagagacgggcaagcacgccgcagcccttacgggaggaagcataggcgtgttgcatgga
tccaaatcctacatcctccaggacgaatacggccagatagtgcctgccgtatccatatcg
gcggggcttgactatccaggtgtggggcctgagcacagcttctatcacgagactggtaga
gtgtattacacctacgcctcagacgacgaagccatagaggccttcaagctcctatgcgag
actgaaggcataatcccggcacttgaaagcgctcatgcccttgcttacctgatgcgcgag
tatagaaacatcaagccaggttcgttggtcgtcttatgcctttcgggaaggggagacaag
gatatggaggcattgaagggaaaactttttaaggaggaagagtaa

DBGET integrated database retrieval system