KEGG   Anaerobaculum mobile: Anamo_1811Help
Entry
Anamo_1811        CDS       T02151                                 

Definition
(GenBank) tryptophan synthase, alpha chain (EC:4.2.1.20)
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
amo  Anaerobaculum mobile
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:amo00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Anamo_1811
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Anamo_1811
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Anamo_1811
Enzymes [BR:amo01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Anamo_1811
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1830341..1831129
Genome map
AA seq 262 aa AA seqDB search
MRTIAEAFDSGKLLIPYICAGDPNLHTTAQIIKELDKLGAGIIEVGMPFSDPLADGPVIQ
AASQRALASGTTMPKIFEMLSEIKGLSAPIVLMGYINPIMKYGESSFVRDALACNVSGVL
IPDLPFDEGKEFYDMCASEGLCPIYMVTPNTDDERLGQIGRVAKGFLYCVSLLGITGDAR
GPIDEIKSYMESVRTHTSVPLALGFGIDSPEKVKAVKPYVDGIVVGSAIVKIIAEKSALG
EGAIKDEVSTFVSSFLRALREQ
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
atgaggacgatagccgaagcttttgatagtggtaaacttctcatcccttacatctgtgcc
ggcgacccaaaccttcacacgacggcacagatcataaaggagcttgataaactcggagca
gggataatagaggtaggcatgcccttttcggaccccttggcagacggtcccgtcattcag
gcggcatcccaacgggccctagccagcggaacaaccatgccgaagatattcgagatgctg
agcgaaataaagggcctcagcgcacctatcgtgttaatgggatatattaaccccataatg
aaatacggtgaaagctcatttgtaagagacgcactggcctgcaatgtttctggcgtactc
atacctgaccttcccttcgacgaaggcaaggaattttacgatatgtgtgcaagcgaaggt
ttatgtccgatctacatggtcacgcccaacacggacgacgaaaggctgggtcaaatcgga
agggtggccaaaggtttcttgtactgcgtatccctccttggcataacgggagatgcgaga
gggcccatcgatgaaataaagtcgtacatggaaagcgtcaggacgcacacatccgtcccg
cttgcccttggctttgggatagatagcccagaaaaagtaaaggccgtaaaaccttacgta
gacggcatagtcgtcggaagcgcgatcgtaaagataattgccgaaaaatcagcccttggg
gaaggggcaattaaagacgaggtatccaccttcgtgtcaagttttttaagggccctaagg
gaacagtaa

DBGET integrated database retrieval system