KEGG   Anaerobaculum mobile: Anamo_1811Help
Entry
Anamo_1811        CDS       T02151                                 

Definition
tryptophan synthase subunit alpha (EC:4.2.1.20)
Orthology
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
amo  Anaerobaculum mobile
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:amo00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Anamo_1811
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Anamo_1811
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Anamo_1811
Enzymes [BR:amo01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Anamo_1811
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1830341..1831129
Genome map
AA seq 262 aa AA seqDB search
MRTIAEAFDSGKLLIPYICAGDPNLHTTAQIIKELDKLGAGIIEVGMPFSDPLADGPVIQ
AASQRALASGTTMPKIFEMLSEIKGLSAPIVLMGYINPIMKYGESSFVRDALACNVSGVL
IPDLPFDEGKEFYDMCASEGLCPIYMVTPNTDDERLGQIGRVAKGFLYCVSLLGITGDAR
GPIDEIKSYMESVRTHTSVPLALGFGIDSPEKVKAVKPYVDGIVVGSAIVKIIAEKSALG
EGAIKDEVSTFVSSFLRALREQ
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
atgaggacgatagccgaagcttttgatagtggtaaacttctcatcccttacatctgtgcc
ggcgacccaaaccttcacacgacggcacagatcataaaggagcttgataaactcggagca
gggataatagaggtaggcatgcccttttcggaccccttggcagacggtcccgtcattcag
gcggcatcccaacgggccctagccagcggaacaaccatgccgaagatattcgagatgctg
agcgaaataaagggcctcagcgcacctatcgtgttaatgggatatattaaccccataatg
aaatacggtgaaagctcatttgtaagagacgcactggcctgcaatgtttctggcgtactc
atacctgaccttcccttcgacgaaggcaaggaattttacgatatgtgtgcaagcgaaggt
ttatgtccgatctacatggtcacgcccaacacggacgacgaaaggctgggtcaaatcgga
agggtggccaaaggtttcttgtactgcgtatccctccttggcataacgggagatgcgaga
gggcccatcgatgaaataaagtcgtacatggaaagcgtcaggacgcacacatccgtcccg
cttgcccttggctttgggatagatagcccagaaaaagtaaaggccgtaaaaccttacgta
gacggcatagtcgtcggaagcgcgatcgtaaagataattgccgaaaaatcagcccttggg
gaaggggcaattaaagacgaggtatccaccttcgtgtcaagttttttaagggccctaagg
gaacagtaa

DBGET integrated database retrieval system