KEGG   Acetomicrobium mobile: Anamo_1811Help
Entry
Anamo_1811        CDS       T02151                                 

Definition
(GenBank) tryptophan synthase, alpha chain
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
amo  Acetomicrobium mobile
Pathway
amo00260  Glycine, serine and threonine metabolism
amo00400  Phenylalanine, tyrosine and tryptophan biosynthesis
amo01100  Metabolic pathways
amo01110  Biosynthesis of secondary metabolites
amo01130  Biosynthesis of antibiotics
amo01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:amo00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Anamo_1811
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Anamo_1811
Enzymes [BR:amo01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Anamo_1811
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA PcrB ALF His_biosynth
Motif
Other DBs
NCBI-ProteinID: AFM22397
UniProt: I4BYP0
Position
1830341..1831129
Genome map
AA seq 262 aa AA seqDB search
MRTIAEAFDSGKLLIPYICAGDPNLHTTAQIIKELDKLGAGIIEVGMPFSDPLADGPVIQ
AASQRALASGTTMPKIFEMLSEIKGLSAPIVLMGYINPIMKYGESSFVRDALACNVSGVL
IPDLPFDEGKEFYDMCASEGLCPIYMVTPNTDDERLGQIGRVAKGFLYCVSLLGITGDAR
GPIDEIKSYMESVRTHTSVPLALGFGIDSPEKVKAVKPYVDGIVVGSAIVKIIAEKSALG
EGAIKDEVSTFVSSFLRALREQ
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
atgaggacgatagccgaagcttttgatagtggtaaacttctcatcccttacatctgtgcc
ggcgacccaaaccttcacacgacggcacagatcataaaggagcttgataaactcggagca
gggataatagaggtaggcatgcccttttcggaccccttggcagacggtcccgtcattcag
gcggcatcccaacgggccctagccagcggaacaaccatgccgaagatattcgagatgctg
agcgaaataaagggcctcagcgcacctatcgtgttaatgggatatattaaccccataatg
aaatacggtgaaagctcatttgtaagagacgcactggcctgcaatgtttctggcgtactc
atacctgaccttcccttcgacgaaggcaaggaattttacgatatgtgtgcaagcgaaggt
ttatgtccgatctacatggtcacgcccaacacggacgacgaaaggctgggtcaaatcgga
agggtggccaaaggtttcttgtactgcgtatccctccttggcataacgggagatgcgaga
gggcccatcgatgaaataaagtcgtacatggaaagcgtcaggacgcacacatccgtcccg
cttgcccttggctttgggatagatagcccagaaaaagtaaaggccgtaaaaccttacgta
gacggcatagtcgtcggaagcgcgatcgtaaagataattgccgaaaaatcagcccttggg
gaaggggcaattaaagacgaggtatccaccttcgtgtcaagttttttaagggccctaagg
gaacagtaa

DBGET integrated database retrieval system