KEGG   Anaerobaculum mobile: Anamo_2026Help
Entry
Anamo_2026        CDS       T02151                                 

Definition
fructose 1,6-bisphosphatase
Orthology
K01622  
fructose 1,6-bisphosphate aldolase/phosphatase [EC:4.1.2.13 3.1.3.11]
Organism
amo  Anaerobaculum mobile
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:amo00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Anamo_2026
   01230 Biosynthesis of amino acids
    Anamo_2026
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Anamo_2026
   00030 Pentose phosphate pathway
    Anamo_2026
   00051 Fructose and mannose metabolism
    Anamo_2026
  Energy metabolism
   00680 Methane metabolism
    Anamo_2026
Enzymes [BR:amo01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.11  fructose-bisphosphatase
     Anamo_2026
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.13  fructose-bisphosphate aldolase
     Anamo_2026
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2074741..2075841
Genome map
AA seq 366 aa AA seqDB search
MRVTLTAIKADIGSIGGHIRPSASLLKEVERSLQPHLGSDFIDFRLSYTGDDIAILMTHT
HGTDNPLIHQIAWDAFKAAADVAKKEGLYGAGQDLLKDAFSGNIRGLGPGIAEMEFEERK
SEPFLLFAADKTDPGAFNLPLYLAFCDPMYCSGLLLSPNMFKGFKFEIMDVSYTEGDKVI
ALFAPEELYDIAALLRDPERYVVKAVYSRTTGEIAAVASTTRLHNIAGKYVGKDDPILLV
RAQGSFPATGEILEPYALVPYVGGFMRGSHQGPLMPVKRNSSVSFFDGPPIVSCTAYCVK
DGKLSEEADAFDHPFWDYVREIASKKAIELRRQGFYGNAMLPYGELEYGGIVERLKALEG
KFEIRH
NT seq 1101 nt NT seq  +upstreamnt  +downstreamnt
ttgagagtaaccctaacagcgatcaaggccgacataggaagcattggagggcacattcgc
cccagtgcttcgctgctcaaggaagtggaaaggtctcttcagcctcatctgggcagtgat
ttcatcgatttccgcctttcctacacgggagacgacatcgccatattgatgacccacact
cacggcacggacaacccgctcatccaccagatagcctgggacgccttcaaggctgccgcc
gacgtggcaaagaaagagggcctctatggtgcgggacaggacctgctaaaggatgccttc
tccggcaacataagggggcttgggcccggcatcgctgagatggagttcgaggaaagaaaa
agcgagcctttcctgctttttgccgccgataagaccgatcccggtgcattcaacctgccg
ctttaccttgccttttgcgatcccatgtactgcagcgggctgcttctttcgccgaacatg
ttcaaggggtttaagtttgagatcatggacgtctcatacaccgagggcgataaagtaata
gctctcttcgcacctgaggagctctacgacatcgcggcgctgcttcgagatcctgagcgc
tacgtggtaaaagccgtctactccaggacgaccggggaaatagcagccgtcgccagcacc
acaaggcttcacaacatagcgggcaaatacgtcggaaaagacgatccaatacttctagtc
agggcacagggcagttttcccgccacgggagagatacttgagccttacgctctcgttccc
tacgtgggcggatttatgaggggaagccaccaagggcctctcatgcccgtcaagcgaaac
agctccgtgtccttcttcgacggcccgccaatcgtgagctgcaccgcctactgcgtaaag
gatggcaagctgtccgaagaggccgacgcctttgaccatcccttctgggattacgtgagg
gagatagcctcaaaaaaggcgatagagctgcgcaggcaaggattttacggaaacgccatg
ctgccctacggggaacttgaatacggcggcatagtcgagaggctcaaggccttggaaggc
aagttcgagatcaggcattaa

DBGET integrated database retrieval system