KEGG   Acaryochloris marina: AM1_0140Help
Entry
AM1_0140          CDS       T00617                                 

Gene name
glk
Definition
glucokinase
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
amr  Acaryochloris marina
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:amr00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    AM1_0140 (glk)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AM1_0140 (glk)
   00052 Galactose metabolism
    AM1_0140 (glk)
   00500 Starch and sucrose metabolism
    AM1_0140 (glk)
   00520 Amino sugar and nucleotide sugar metabolism
    AM1_0140 (glk)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    AM1_0140 (glk)
   00524 Butirosin and neomycin biosynthesis
    AM1_0140 (glk)
Enzymes [BR:amr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     AM1_0140 (glk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
137260..138318
Genome map
AA seq 352 aa AA seqDB search
MQTILAGDIGGTKTILRLVKAEPSLSHPSIPQLTTLSERTYPSQDFPDLSPMIEQFLAQF
DAGTATQAACFGIAGPVVDDTSELTNLSWSLNARRLESEFGINRVALINDFASVGYGILG
LGEQDIATLQAVPANPKAPIAVIGAGTGLGEGFLMPNTKGYQVFPSEGGHADFAPRTPIE
FQLLDFLREEMKLDRVSVERVVSGKGIVSVYRFLRSLGQHPESSEIAQVFQAWEKREGTA
ENLVDPAAAIAQAALQKTDPLCQQTLTLFVEAYGAEAGNLALKLLPYGGLYIAGGVAAKI
LPLLQTGAFLKTFQTKGRVSPLLHKVPIHVVLNPKVGLMGSAIYAAQLSADS
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaccattcttgctggggatattggaggcactaaaaccattctgcgcctcgtcaaa
gcagaaccgtcgctgtcccacccctccattccccagctgacaaccttatctgagcggact
tatccaagccaagactttccagacttaagtcctatgattgagcagtttctggctcaattc
gatgcaggaacggccacccaggcagcctgttttggtattgctggccctgtggtcgatgat
acgtcagaactcaccaacttatcttggtctctaaatgctcgtcgtctggagtcagagttt
ggcatcaaccgtgttgccctgatcaatgactttgcttcagtagggtatggcattttgggc
ttaggagagcaggatattgcgacactgcaggcagtccctgcaaacccgaaagcccccatt
gccgtcattggtgccggtactggattaggagagggattcttaatgccgaatactaaaggc
tatcaagtctttcccagtgaaggggggcatgcagattttgcaccccgcacaccgatcgag
tttcagctgctcgatttcttgcgagaggagatgaagctagaccgggtttccgtagaacga
gtcgtgtccggcaaggggatagtctcggtctatcgatttctacgcagtttagggcaacat
ccagagtcatctgagattgctcaagtctttcaggcttgggagaaaagagagggcacagcc
gaaaatttagttgatccggcagctgcgatcgcacaagccgccttgcagaaaacggatccc
ctttgccagcaaaccttaaccctctttgtcgaagcctacggagccgaagccgggaatctg
gccttaaaactgttgccctatgggggactgtatattgccgggggggtagccgccaaaatt
ttgcctttattgcagacaggcgcattccttaaaacatttcagacgaagggacgggttagt
cctctccttcataaagtccccattcatgtcgtactcaatcccaaagtagggctcatgggt
tccgctatttatgcagcccagctctcagcagattcttag

DBGET integrated database retrieval system