KEGG   Acaryochloris marina: AM1_0442Help
Entry
AM1_0442          CDS       T00617                                 

Definition
bifunctional acetaldehyde-CoA/alcohol dehydrogenase
Orthology
K04072  
acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Organism
amr  Acaryochloris marina
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Pyruvate metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:amr00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    AM1_0442
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AM1_0442
   00620 Pyruvate metabolism
    AM1_0442
   00650 Butanoate metabolism
    AM1_0442
  Lipid metabolism
   00071 Fatty acid degradation
    AM1_0442
  Amino acid metabolism
   00350 Tyrosine metabolism
    AM1_0442
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    AM1_0442
   00626 Naphthalene degradation
    AM1_0442
Enzymes [BR:amr01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     AM1_0442
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     AM1_0442
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
419442..422150
Genome map
AA seq 902 aa AA seqDB search
MMTTQTQPQVTDIPSLEDLIARVKQAQEVYATYTQEQVDHIFKQVAIAANAERIPLAKQA
VAETGMGVIEDKVIKNHFASEYIYNKYKHEKTCGVVSADAHYGIQKVAEPLGIVAGIIPT
TNPTSTAIFKALLCLKTRNAIIFSPHPRAKHCTVRAVEIIRDAALQAGAPPDIVGWIDEP
TLDLSQALMQHADIKLILATGGPGMVKAAYSSGHPSLGVGAGNTPAVIDETADIQVAVSS
ILLSKTFDNGMICASEQSVVVTEAVYEQVKQEFRKRGAYFLTSEEKDKVAQTILKNGKLN
PAIVGQPISELATLAGIEGPQDHKVLIGEVSTIGSSEPFAYEKLSPILAMYRAADFTDAV
DQAKQLVNFGGRGHTSVLYTAASNCDRIRIFETELATARVLINTPSSQGAIGDLYNFKLD
PSLTLGCGTWGGNSISGNVNVQHLLNIKTVTERRENMLWFRVPPKIYFKYGCIPVALRDL
AEKKRAFIITDRPLFDLGLTKEITETLDQLGIEHHLFFDVEPDPDLSTVKRGLDVINTFQ
PDVIIALGGGSPMDAAKVMWLMYEHPEVEFDGLAMRFMDIRKRVYELPPLGNKAILVAVP
TTSGTGSEVTPFAVVTDDRVGIKYPLADYALTPTMAIVDPELVLNMPKKLTAYGGVDALT
HALEAYVSVLATEFTDGLALEAISLLMTYLPRAYHQGSADPEAREKVHYAATIAGLAFAN
AFLGICHSLAHKLGSTFHVPHGLANALMISHVIRYNATDAPFKQAIFPQYEYPQAKGRYA
AIADSLNLRGTTADEKVERLITAIENLKQELDIPSSIREVLSVDEQTFFEHLDLMSEQAF
DDQCTGANPRYPLIRDLKALYLEAYQNSSQATTLATEIALEAAAHNQALLGKNINFTSIE
NS
NT seq 2709 nt NT seq  +upstreamnt  +downstreamnt
atgatgacgactcaaacccagcctcaagtcaccgatattccttccctagaagatctgatt
gcccgagtgaagcaagcccaggaggtctatgccacctatacccaggagcaggtggaccat
atctttaagcaagttgcgatcgcagccaatgccgaacgcattcctctagccaaacaggcc
gtggctgagacggggatgggggtgattgaagacaaggtgatcaaaaaccactttgcttcc
gaatatatctataacaagtacaaacacgaaaaaacctgcggcgtcgtgtcagcggatgcc
cattacggcatccaaaaagtggcggaacccctaggcattgtggcggggattatccccacc
accaaccccacttcaaccgctatttttaaggcgttgctctgtctcaagacccgcaacgcc
attattttttctcctcatcctcgggccaaacactgcacagtgcgagcggttgaaattatc
cgcgatgctgcccttcaagccggggcacctcccgatatcgtcggctggattgacgaaccg
accttggacctctcccaagccctgatgcagcatgccgatattaagctgattctggccacc
ggtggccccggtatggtcaaagcagcttactcgtcggggcatccctccttaggggtcggt
gctggcaatacccctgccgtgattgatgaaacggcggatatccaagttgctgtcagctcc
atcttgctcagcaaaacctttgacaatggcatgatctgcgcctctgagcagtcagttgtg
gtgacagaagccgtctacgagcaggtcaaacaagagtttcgcaagcgaggggcttacttc
cttacctctgaagaaaaggataaagtcgcccagaccatcctcaagaacggcaagttaaac
ccggccattgtgggtcaacccatttcagagttagccactttggcagggattgagggtccc
caggatcataaagtcttaattggtgaagtctccactattggtagtagcgaaccctttgcc
tatgagaagctatccccgattttggccatgtatcgggccgcggattttaccgatgctgtg
gatcaggccaaacagttggtcaactttgggggtcgcggccatacctccgtgctgtatacg
gcggcatccaattgcgatcgcatccgcattttcgaaacggaactcgccacagcccgagtc
ttgatcaacaccccctcttcccaaggggccattggcgacctctataacttcaagctagat
ccatctttgaccctaggctgtggcacctggggcggtaactccatctctggcaatgtcaac
gttcagcatctgctcaatatcaaaactgtcaccgagcgccgggaaaatatgctgtggttc
cgggtgccgcctaaaatctactttaaatacggctgtattcccgttgctttgagagattta
gccgagaaaaagcgagcctttattatcaccgatcgtcctctgtttgatctgggcttgact
aaggaaattaccgagaccttagatcaactgggcatcgagcaccatctatttttcgatgtc
gaacccgatccagacctatccacggtgaaacggggcttagatgtaattaataccttccaa
ccggacgtgattattgctttaggcggcggttcacccatggatgcagctaaggtgatgtgg
ctgatgtatgaacatcccgaagtcgagtttgacggtctagccatgcggtttatggatatc
cgaaagcgcgtctatgaactgcctcccttgggaaataaagccatcctggtggctgtcccc
accacctcaggcaccgggtcggaggtcaccccctttgccgtggtcacggatgatcgggtg
ggcattaaatatcccttggccgactatgccctgactccgacgatggccatcgttgatcca
gagctggtcctcaatatgcccaaaaagctgacggcctatggtggggttgatgccctgacc
catgctctggaagcctatgtatcggtcttggcaacggagttcacggatggactggcctta
gaagccattagtttattaatgacttacttgcccagagcctatcatcagggcagtgctgat
ccagaagcccgagaaaaggtccactacgcggcaacgattgctggtttggcctttgccaac
gccttcttaggaatttgccactctctggcccacaaattgggatctaccttccatgtcccc
catgggttggcgaatgcgttgatgatttcccatgtgattcgctataacgccacggatgcc
ccctttaagcaggctatttttccccagtacgaatatccccaggctaagggtcgctacgct
gcgatcgcagattccctcaacttaaggggaaccaccgccgatgaaaaagtagagcgcttg
ataacagccatcgaaaacctgaagcaagagttggatattccatcctcgattcgtgaagtc
ttatccgtcgatgagcagaccttttttgagcacctagatctgatgtcggaacaagccttt
gacgatcagtgcacaggggccaatcctcgctatccattgattcgcgatttaaaagccctc
taccttgaggcttaccagaattcttcgcaggcgacgactttagcgaccgaaattgcccta
gaagcggcagcacacaatcaggccctgctcggtaaaaacattaacttcacatctatagag
aacagttga

DBGET integrated database retrieval system