KEGG   Acaryochloris marina: AM1_0533Help
Entry
AM1_0533          CDS       T00617                                 

Gene name
chlD
Definition
magnesium protoporphyrin IX chelatase subunit D
Orthology
K03404  
magnesium chelatase subunit D [EC:6.6.1.1]
Organism
amr  Acaryochloris marina
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:amr00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    AM1_0533 (chlD)
Enzymes [BR:amr01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     AM1_0533 (chlD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(513298..515346)
Genome map
AA seq 682 aa AA seqDB search
MPVAELPQKITTFPLTAVVGQEAIKLALLLTAVDPTLGGVVIAGRRGTAKSVMARAVHAL
LPPIEVVKGSICQGDPEDTSAWDDDLLASLEAGAIPIVDGQPQPETEIIPTPFVQVPLGV
TEDRLLGSVDVSQSVKLGETVFQPGLLAEANRGVLYVDEINLLDDQISNLLLTSLTEGRN
QIEREGLSFQHPCSTIFIATYNPEEGPLREHLLDRIAISLSADQMLGLDLRVQAVEQATA
YANSPQAFLAQYEDETDDLKTQILLAREWLKDVQIQHSQIVYLVDEALRGGVQGHRAELF
AVRVAKAHAALNGRSEVTAEDLRRAVELVIVPRATVIDAPPPEQPQPPPPPPPQQDNSDQ
SDQDEEEEDDQNEEDPPEPEEPPSIPEEFVFDPDGVVLDPQVLYFAQNASRQGKSGSRSI
VFSEDRGRYVKPMLPKGGVKRIAVDATLRAAAPYQKARRLRHPNRRVIVEQSDVRTKRLA
RKAGALVVFVVDASGSMALNRMQSAKGAVMRLLTEAYQNRDQVSLIPFRGERADVLLPPT
RSIEAARRRLDTLPCGGGSPLAHGLTQAVRVGMNALSSGDIGQVVLVAITDGRGNIPLTT
SLGEPPVDGEKPDIKAELLEIAGRIRALNLKLLVIDTENKFISTGFAKELAQNAGGNYYH
LPKATDQAIAAVTQDAISNLTG
NT seq 2049 nt NT seq  +upstreamnt  +downstreamnt
atgccagttgctgaacttccccaaaaaataaccacctttcccctcacagctgtggtgggt
caagaagcgattaaattggcattattgctcacagcagttgatccaactctgggcggggtc
gttattgcgggtcggcgagggaccgcgaaatcagtcatggcccgagcggttcatgccctt
ctcccccccatcgaagtggtcaaaggctccatctgccaaggcgatccagaggatacttct
gcttgggatgatgacctattggccagtctagaggctggtgccattccgatagtggatgga
cagccccaacccgaaaccgaaattattccgaccccatttgtccaggttcctttaggagtg
acagaagatcggctgttaggttctgtggatgttagccaatccgtaaagctaggagaaacc
gtatttcaacccggactgttggcagaggccaatcggggcgtcttatatgtggatgagatt
aatctactggatgaccagatttccaatttattgctgactagcctaacggaaggtcgaaat
caaatcgaacgcgaggggctcagcttccaacatccttgctctactatttttattgccact
tacaatccagaagaaggtcctctacgggaacatctgctagatcgtatcgctatttccctc
tcagccgatcagatgttgggccttgacctgcgagttcaggcagtggagcaggctactgcc
tatgccaattctcctcaagcatttttagcacagtatgaggatgaaacagatgatttaaaa
actcagattttgctggcgcgagaatggctcaaggatgttcagattcaacactctcagatt
gtctatcttgtggatgaagctctcagaggcggagtgcaaggtcatcgagccgaactattt
gccgttcgtgtagccaaagcccatgcggccctcaatggccgttcagaagtcactgcagaa
gatttacggcgtgctgttgaattagtgattgtccctcgggcaacggtcattgatgcccca
cccccagaacaaccacaacccccacctccccctccacctcaacaagataattccgatcag
tcagatcaagatgaagaagaagaggacgatcaaaacgaagaagatccaccggaaccagaa
gagccccccagcattcccgaagaatttgtgttcgatcccgatggtgttgtcctcgatccc
caagtcttatactttgcccaaaatgctagccgacaagggaaatcaggtagtcggagtatt
gtcttttcggaagatcgaggacgctatgtcaaacccatgttgcccaagggcggtgttaaa
cgaattgctgttgacgccacgttgagagcggcagctccctaccaaaaggcacggcggttg
cgccacccgaatcggcgagtcattgttgagcagtccgatgtccgcaccaaacggttggct
cgtaaagcaggagcattggtcgtgtttgtagtggatgcgtcaggttctatggcccttaac
cggatgcagtcggcgaaaggggccgtgatgcgcttattaacggaagcctatcaaaatcga
gatcaggtttctttgatcccttttagaggggaacgggctgatgtactcctacccccgact
cggtctatcgaagccgctcgccgccgtttggatacgctgccctgtggcggtggatctcct
ttagcccacggcttgacccaagcggttcgggtggggatgaatgccctctcatccggggat
attggtcaggtggtattggtcgcgattacggatggtcgaggtaatattcccttgacaaca
tccttgggtgaaccgccagtagatggggagaaacctgatattaaggctgaactgttagaa
attgcgggtcgcattcgagccttgaatttgaaattgctggtgattgataccgagaacaag
tttatttccactggatttgccaaagagctggcccaaaatgcagggggtaactactatcat
ttgccgaaagccaccgatcaagcgattgccgcagtcacccaagatgccatcagcaacttg
acgggttag

DBGET integrated database retrieval system