KEGG   Acaryochloris marina: AM1_0645Help
Entry
AM1_0645          CDS       T00617                                 

Definition
hypothetical protein
Organism
amr  Acaryochloris marina
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
631592..633139
Genome map
AA seq 515 aa AA seqDB search
MFALCVVGFNQPPSPTIQATQPVSNPQLGMNLGEVVSYTSQWPFVDAFKLSRPWFSGREG
AGFDQGGPLKLTPEGWIAALEPKQFAETVIFDNGKGHYPAGKYTLLYDGEGEISFNYGSA
TIASQQPGRMVLDVTPMETGIWLKINRTNPQNPIRNIRLILPGFEYAYQQRLFHPLFLER
LQPFKTLRFMDWMETNGSDIQEWQDRPQVSDVTQAAGKGVALEYMIDLANTLQANPWFTL
PHQASDDYVRQFATMVRDRLDPRLKVYVEYSNEVWNTAPDFNQYQYAQSKGLELKLAEDP
YQASLRFYSQRSVEIFKLWESVFGSRDRLVRVLASQYVNPWTAEQVLTWKDAYKSADAYA
IAPYFSGEWDYLENLPRLLKSSEAEIWQQMEAEIKSYGPFLREHYSRIRDEFGLDLIAYE
GGQHLTSAAFSEEHEQKITQLFTSLNRHPRMATLYKQYLQQWQESGGGLLCHFVDVSPYT
RFGSWGALEYQNQPLETAPKYQALVDFMAQGSAQQ
NT seq 1548 nt NT seq  +upstreamnt  +downstreamnt
atgtttgcgttatgtgtggtcgggtttaatcagccgccctctcctactatccaggctacc
cagccggtctctaatccacaactcgggatgaatttaggggaggtggtgagttacaccagt
caatggccgtttgtggatgcttttaagctatcgcgcccttggttctcggggcgggaaggg
gctggttttgatcagggaggccccctgaagctcactcctgagggctggattgcagcccta
gaacccaagcagtttgcggagaccgtgatctttgacaatggcaaaggtcattacccggcg
gggaaatacaccctgctgtatgacggagagggagagattagctttaactatggtagtgcc
accattgcgagtcagcagcctggacggatggtattggacgtaacgccgatggagacgggg
atttggttgaaaattaatcgaacaaatccccaaaatcccattcggaatattcgcttgatt
ttacctggatttgaatatgcctatcagcaacgtctttttcatccattgtttctagagcgg
ctgcagcccttcaaaaccttgcggtttatggattggatggaaacgaatggctctgacatt
caagagtggcaggatcggcctcaagtgtcggatgtgacccaagcggctggcaagggagtg
gctttagagtacatgatcgatctggccaatactctacaagccaatccttggtttaccttg
ccccatcaggcctcggatgattatgttcgtcaattcgcgacgatggtacgcgatcggtta
gaccctcggctcaaggtgtacgtggagtactctaacgaggtgtggaacaccgcccccgac
tttaatcaatatcagtatgctcaatccaaaggattggaattaaagcttgcagaagacccc
tatcaagctagcttacgcttctactcccaaagatctgttgagattttcaaactttgggaa
tcggtatttggcagccgcgatcgcctagtgagagtattagcatcccagtatgtcaacccc
tggaccgctgagcaggtgctgacttggaaagatgcctataaatccgcagatgcctatgct
attgcgccttacttcagtggggaatgggattatctggagaatttaccccgattactcaag
agttctgaagccgaaatttggcaacagatggaggcagaaattaagtcctatgggccgttt
ctgcgggagcactatagccgtattcgagacgagtttgggttggatttgattgcctatgag
ggaggacagcatttaaccagtgctgcatttagcgaagaacatgagcagaagattactcaa
ctgtttacctcccttaaccgtcacccccgcatggccactctgtataagcagtatctccag
caatggcaggagtccggtggaggattgctctgtcattttgtagatgtttcgccctatacc
cgttttggcagttggggagcgctggaataccaaaaccaaccattagaaactgccccaaaa
tatcaggcattagtggactttatggcgcaaggttcagctcaacaatga

DBGET integrated database retrieval system