KEGG   Acaryochloris marina: AM1_0920Help
Entry
AM1_0920          CDS       T00617                                 

Gene name
thrC
Definition
(GenBank) threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
amr  Acaryochloris marina
Pathway
amr00260  Glycine, serine and threonine metabolism
amr00750  Vitamin B6 metabolism
amr01100  Metabolic pathways
amr01110  Biosynthesis of secondary metabolites
amr01120  Microbial metabolism in diverse environments
amr01230  Biosynthesis of amino acids
Module
amr_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:amr00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    AM1_0920 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    AM1_0920 (thrC)
Enzymes [BR:amr01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     AM1_0920 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP NinF TF_Zn_Ribbon
Motif
Other DBs
NCBI-ProteinID: ABW25962
UniProt: B0BZN6
Position
complement(888193..889491)
Genome map
AA seq 432 aa AA seqDB search
MTQTLTNQSRSSALKALKCKECGAEYELQATHVCEFCFGPLEASYDFSRLSQPITRESIE
AGPNSIWRYRSFLPVETDTPIDVGTGMTPLLKSHRLARQLGLKNLYIKNDAVNMPTLSFK
DRVVSVALTRAQELGFSTVSCASTGNLANSTAAIATRAGLDCCVFIPADLEAGKVMGTLI
YGPTVMAVQGNYDQVNRLCSEVANTHGWGFVNINLRPYYSEGSKTLGYEVAEQLGWELPD
HIVAPLASGSLFTKIYKGFREFVDNGLVDDKAVRFSGAQAEGCSPIAQAYKEDRDFINPV
KPNTIAKSIAIGNPADGVYAIDIAKKTNGTIESVTDAEIVEGMKLLAETEGIFTETAGGT
TIAVLKKLVEAGKIDPEEKTVVYITGNGLKTQEAVQGCIGQPFEIEPKLGSFERALERSR
TLDRLDWQPVLV
NT seq 1299 nt NT seq  +upstreamnt  +downstreamnt
atgactcaaaccctgaccaatcaatctcgcagctcagctctgaaagcactgaagtgtaaa
gaatgtggcgctgagtatgaattgcaagccacccacgtttgtgaattctgctttggcccc
ctagaagcgagctatgacttcagccgcctcagccagccgatcactcgtgaaagcattgaa
gccggccccaattccatttggcggtatcgctccttcttgcccgttgagacagatacaccc
attgatgtgggaacggggatgacccctttgctcaaatcccatcggctagctcggcaattg
ggcctcaaaaatctctatatcaagaacgatgccgtcaatatgcccaccctgagctttaag
gatcgggtggtatcggtggcattgactcgggcacaagagttgggtttctctaccgtgtcc
tgtgccagtactgggaacttagccaattcaacggctgctattgcaacccgggcgggcctt
gattgttgtgtatttattccagcggatttagaagcgggtaaggtcatgggtaccctcatc
tacggtccaacggtcatggcggttcaaggcaactacgatcaagtcaatcgtctctgttca
gaagtcgccaacacccacggttggggattcgtcaacatcaatttacgtccctattattct
gaggggtctaagacccttggttacgaagtggcggaacagctgggttgggaacttcccgat
cacattgttgcaccgctagcatctggatccttatttaccaagatttataagggcttccgg
gaattcgtcgacaatggtttggtcgatgataaagcagttcggtttagcggtgcccaggcc
gaaggctgctctcccatcgctcaggcctacaaagaagatcgcgactttatcaatcctgtc
aaaccgaatacgattgctaaatccattgccattggaaatcctgcagacggggtttatgcc
atcgatattgccaagaaaaccaacggcacgattgaatcggttaccgatgctgagattgtc
gaaggcatgaagctgttggctgaaacggaaggcatctttacagaaacagccggtggaacc
accattgctgttcttaagaaactcgttgaagccggtaaaattgacccggaagaaaaaacc
gtggtttacattacgggcaatggcctcaagacccaagaggcagtccaaggttgtatcggt
cagccctttgagattgagcctaaacttggtagctttgagcgagccctagagcgctcccgc
accctggatcgattggactggcaacctgtgctggtttag

DBGET integrated database retrieval system