KEGG   Acaryochloris marina: AM1_0996Help
Entry
AM1_0996          CDS       T00617                                 

Gene name
glgB
Definition
glycogen branching protein
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
amr  Acaryochloris marina
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:amr00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
968642..970951
Genome map
AA seq 769 aa AA seqDB search
MSTPLTADQVNRIVWNHHHDPFEVLGPHPSQDGKSGWVVRAYWPKADAISVVCPEHRQEY
PMQSVHDPHFFECEVPIPGALNYQLRVKEGSHEQVLYDPYAFKSPRVTEYDQHLFAEGNH
HRIYEKLGAHLTTLDGVEGVYFALWAPNARNVSLLGDFNAWDGRQHQMRKGPSGIWELFI
PELSIGEHYKYEVKNYEGHIYEKSDPYGFQQEVRPKTASIVTDLNSYSWSDESWMEQRRN
ADALAQPISIYEVHLGSWMHASSDEPPTSEEGHPLPPVIVSELKPGARFLTYRELAERLI
PYVKDLGFTHIELLPVAEHPFDGSWGYQVTGYYACTSRYGTPEDFMYFVDQCHQQDIGVI
VDWVPGHFPKDGHGLAFFDGTHLYEHADPRKGEHKEWGTLVFNYSRKEVKNFLIANALFW
FDKYHIDGIRVDAVASMLYLNYCRKDGEWVANEYGGAENIEAADFLRHLNDVLFSYYPGI
LSIAEESTSWPMVSWPTYVGGLGFNLKWNMGWMHDMLDYFNMDPWFRQFHQNNVTFSIMY
AFSENFMLALSHDEIVHGKSNMLGKMPGDEWQKFANLRCLYTFMFTHPGKKTLFMSMEFG
QWSEWNVWGDLEWQLLQYDPHQNLKKFVTDLNHLYKELPALFTNDFSYDGFEWVDCNDNR
HSVISFVRRAKDSDEFVLTVCNLTPQPHSHYRVGVPEAGYYVERFNSDGRQYGGSNMGNL
GGKWTDEWAFHNRPYSLDLCLPPLATLVFTLDREKTAQAYQQLPDSQNQ
NT seq 2310 nt NT seq  +upstreamnt  +downstreamnt
atgtccacccctcttactgccgatcaagttaatcgaattgtttggaatcaccatcacgat
cccttcgaggttctcggtccccatcccagtcaagatggcaaatcagggtgggttgtgcgg
gcatattggccaaaagcagatgcaatttctgtggtgtgtcccgagcacagacaggaatat
cccatgcagagtgttcatgatcctcacttttttgaatgtgaggtgcccatccccggagcg
ctcaattaccaacttcgagtgaaagaagggagtcatgagcaagtcctgtacgatccctac
gctttcaagtctccccgagtcacagaatacgatcagcatttgtttgcggaagggaatcac
caccgcatctatgaaaagctgggcgcacatctcaccactttagatggcgttgaaggggtt
tactttgccctttgggctcccaatgcccgtaatgtttctctcttgggtgattttaatgcc
tgggatggacgccaacatcagatgcgtaaaggaccatccggcatttgggaattattcatt
ccagaattgagcatcggcgagcactataaatacgaagtcaaaaattatgaggggcatatt
tacgaaaaatctgacccctatggttttcaacaagaagtccgcccgaaaaccgcttctatc
gtcaccgatctcaactcctatagctggtccgatgagtcctggatggagcagcgacgcaat
gcggatgccttagcacaaccgatttcgatttacgaagtgcatctggggtcctggatgcat
gcctcctctgacgaacctccgacatcagaagaaggccatcccctccctcccgttattgtc
tctgagctgaagcctggcgctcggttccttacctatcgagagttggcagagcgattaatt
ccctacgttaaagacctaggcttcacccatatagaactcttgcctgtggccgagcacccc
tttgacggatcttggggctatcaagtgacaggctactacgcctgtacctctcggtatgga
actcccgaagactttatgtatttcgtcgaccaatgccaccaacaggacatcggcgtgatt
gtcgattgggtcccaggacattttcccaaagacggccatggtttagccttttttgatggc
acccatttatatgaacatgccgatccccgtaagggagagcataaagaatggggcacgctg
gttttcaattacagccgcaaggaagtcaagaatttcctgattgcgaatgccctcttttgg
ttcgataagtaccatatcgatggcatccgtgtcgatgctgttgcctccatgctctatctc
aattactgtcgcaaggatggtgagtgggtggccaatgagtatggaggggccgaaaatatc
gaagcggcagatttcctacgccacctcaatgatgtgctcttcagctactaccccggtatt
ctttcgattgccgaagaatcaacctcttggcccatggtgtcttggcctacctatgtgggg
ggcttaggctttaacctcaaatggaatatgggatggatgcatgacatgttggattatttc
aacatggatccctggttccgccaatttcatcaaaacaatgtcacgtttagcatcatgtat
gcctttagtgagaactttatgttggccctgtctcacgatgaaattgtgcatggcaaaagc
aatatgctgggcaaaatgcctggagatgagtggcagaaatttgctaacttgcggtgtcta
tacacctttatgtttacccatcccggcaaaaagactctatttatgagcatggagtttgga
caatggagtgagtggaacgtctggggagatttggaatggcagctcttgcagtatgacccc
catcaaaatctcaagaaatttgttaccgacttgaaccacctttacaaagaattaccggcc
ttattcaccaacgacttcagctatgacggttttgagtgggtcgactgtaacgacaatcgc
catagcgtgatctcctttgttcgtcgtgcgaaggactcggatgagtttgtactcacagtc
tgcaatttgactccccaacctcatagccattaccgagtgggggtacccgaagcgggctat
tacgtcgagcgctttaatagcgatgggcgtcaatacggcgggagtaacatggggaattta
ggggggaaatggacagatgaatgggctttccataaccgcccctactctctagatctctgt
ttgccgcctttagctactttggtcttcaccctcgatcgggaaaaaacggcacaagcctac
cagcaacttcctgattcgcaaaatcaatag

DBGET integrated database retrieval system