KEGG   Acaryochloris marina: AM1_1138Help
Entry
AM1_1138          CDS       T00617                                 

Definition
(GenBank) phosphoglycerate mutase, putative
Organism
amr  Acaryochloris marina
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: ABW26177
UniProt: B0C2W1
Position
complement(1109085..1109747)
Genome map
AA seq 220 aa AA seqDB search
MRLLLIRHAEAQGNAQHRMLGQLDELLSPHGVLQAQLLGQWLSQQSWRPTHLYCSPLKRA
MMTLEMLVACHPEGDDFPPIQTDEALLEIDNGIFQGLTWQEAQEQHPELCEQLMNSQEVI
PIPGGETLFDCCDRTRRFIHTLYQTHQPSDRAWVVTHGGILQYLIAAILDTHVDWSIKIG
NTALFEFEIALSSTSPSKPNPQLCRIHRFNECPHLLGEQN
NT seq 663 nt NT seq  +upstreamnt  +downstreamnt
atgcgattgctgttgattcgccatgccgaggcccagggaaatgcccaacataggatgtta
gggcagttagatgagctactgtcgccccacggggttctgcaagctcagctcttgggacag
tggttatcccaacaaagctggcgaccaacacatctttactgtagtcccctcaagcgagcg
atgatgaccttggagatgctggtagcttgccacccggagggcgatgattttcccccgatt
caaacggatgaggctctactggaaattgacaatggcatttttcaagggctgacttggcaa
gaggcccaagagcagcaccctgaactgtgtgaacagttgatgaatagccaggaggtaatt
cccattccagggggggagaccttgtttgattgttgcgatcgcactcgccgtttcatccac
accctctatcaaactcaccaaccttcagatcgagcttgggtagtgacccatggggggatc
ttgcaatatcttattgccgctatccttgatacgcacgtcgattggagcataaagattggc
aacacagctctgtttgaatttgaaattgctttgtcttctacttctccatccaaaccaaat
ccccagctatgccgcattcaccgatttaatgaatgtccccacttactaggagagcagaat
taa

DBGET integrated database retrieval system