KEGG   Acaryochloris marina: AM1_1138Help
Entry
AM1_1138          CDS       T00617                                 

Definition
(RefSeq) phosphoglycerate mutase
  KO
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
amr  Acaryochloris marina
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:amr00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    AM1_1138
   01230 Biosynthesis of amino acids
    AM1_1138
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AM1_1138
  Energy metabolism
   00680 Methane metabolism
    AM1_1138
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    AM1_1138
Enzymes [BR:amr01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     AM1_1138
Exosome [BR:amr04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   AM1_1138
  Exosomal proteins of melanoma cells
   AM1_1138
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1109085..1109747)
Genome map
AA seq 220 aa AA seqDB search
MRLLLIRHAEAQGNAQHRMLGQLDELLSPHGVLQAQLLGQWLSQQSWRPTHLYCSPLKRA
MMTLEMLVACHPEGDDFPPIQTDEALLEIDNGIFQGLTWQEAQEQHPELCEQLMNSQEVI
PIPGGETLFDCCDRTRRFIHTLYQTHQPSDRAWVVTHGGILQYLIAAILDTHVDWSIKIG
NTALFEFEIALSSTSPSKPNPQLCRIHRFNECPHLLGEQN
NT seq 663 nt NT seq  +upstreamnt  +downstreamnt
atgcgattgctgttgattcgccatgccgaggcccagggaaatgcccaacataggatgtta
gggcagttagatgagctactgtcgccccacggggttctgcaagctcagctcttgggacag
tggttatcccaacaaagctggcgaccaacacatctttactgtagtcccctcaagcgagcg
atgatgaccttggagatgctggtagcttgccacccggagggcgatgattttcccccgatt
caaacggatgaggctctactggaaattgacaatggcatttttcaagggctgacttggcaa
gaggcccaagagcagcaccctgaactgtgtgaacagttgatgaatagccaggaggtaatt
cccattccagggggggagaccttgtttgattgttgcgatcgcactcgccgtttcatccac
accctctatcaaactcaccaaccttcagatcgagcttgggtagtgacccatggggggatc
ttgcaatatcttattgccgctatccttgatacgcacgtcgattggagcataaagattggc
aacacagctctgtttgaatttgaaattgctttgtcttctacttctccatccaaaccaaat
ccccagctatgccgcattcaccgatttaatgaatgtccccacttactaggagagcagaat
taa

DBGET integrated database retrieval system