KEGG   Acaryochloris marina: AM1_1245Help
Entry
AM1_1245          CDS       T00617                                 

Gene name
thrC
Definition
(RefSeq) threonine synthase
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
amr  Acaryochloris marina
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:amr00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    AM1_1245 (thrC)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    AM1_1245 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    AM1_1245 (thrC)
Enzymes [BR:amr01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     AM1_1245 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1230767..1232125
Genome map
AA seq 452 aa AA seqDB search
MSLALDSKPDTDKLTTYFRCIAGCPGKHSIYDVIYTCPICGSLLEVHHEREPLKKRNALQ
WQQLLSSRASTSIWPYGSGVWGMREWVVPSLADENVVSMFEGNTNLFWAERLGKQLGVPD
LWIKLCGNSHTGSFKDLGMTVLVSVVKQMMAQGSSVKAVACASTGDTSAALAAYAAYAGI
PAIIFLPAGKVSTAQLIQPVCNGAHVLALDTDFDGCMNIVKEVTQDNSIYLANSMNSLRI
EGQKTVGIEIIRQFNWQVPDWIIIPVGNLGNISALYKGFKLMMDLGLITRMPRLVAAQTQ
KANPFYESFKNGFKEKISVTAQDTLANAIRIGDPVSYDKAVTAITETNGIVEQASEDELA
AAAAKADLTGMFTCPHTGVALAVLTKLIERGEIKSSDKTVVISTAHGLKFTDFKVGYHES
TLADVNSQHANPAVHLPANADAVKAEIEKRLG
NT seq 1359 nt NT seq  +upstreamnt  +downstreamnt
atgtccctagctctagactccaaacccgataccgataaactgacgacttattttcgctgc
attgccgggtgtcctggcaagcactccatctatgacgtcatatacacctgtcccatctgt
ggcagcttactagaggtgcatcatgagcgggaaccgctgaaaaagcgcaatgccctccaa
tggcagcaattgctcagctcccgagccagcacctccatctggccctacgggagtggtgtt
tggggcatgcgggagtgggtggttccatccctagccgatgaaaatgtcgtcagcatgttc
gaaggcaataccaacttattttgggccgaacgcttaggcaaacaacttggcgtccccgac
ttatggattaagctttgcggcaatagccatacgggtagcttcaaagacctaggcatgacc
gtcttggtcagcgtcgtcaaacaaatgatggcccaaggcagttccgtcaaagccgtggcc
tgcgccagtacaggagacaccagcgccgccctcgccgcctatgccgcctatgcgggcata
ccggccattattttcttgcctgccggtaaagtcagtacggctcagcttattcagcccgtc
tgcaacggtgcccatgtcttagccctcgacactgacttcgatggctgtatgaatattgtc
aaagaggtcacgcaagacaattcaatttacctcgctaactcgatgaacagtctgcgcatc
gaaggacaaaaaaccgtcggcatcgaaattattcggcagtttaattggcaagtccccgac
tggatcatcattcctgtgggcaatttgggcaatatcagcgccctctataaaggcttcaag
ttaatgatggatctggggttgatcactcggatgcccagactcgtcgccgcccaaacgcag
aaagccaatcctttttacgagtcctttaaaaacggattcaaagaaaaaattagcgtaaca
gcccaagacaccctagccaacgccatccgaattggtgacccggtcagttatgacaaagcc
gtcactgcgatcaccgaaacaaacggtattgtcgaacaggccagcgaagacgaattagct
gccgcagctgccaaagctgatttaactgggatgtttacctgtccccatacaggcgttgcc
ttagccgttctcaccaagctgatcgaacggggtgaaatcaaatccagcgataaaaccgtg
gtgattagcaccgcccacggtttgaagttcaccgacttcaaagtgggctaccacgaatcg
accctggctgatgtcaacagccagcatgcgaaccctgctgttcacctgcccgccaatgcg
gatgccgtcaaagctgaaatcgaaaaacgactgggctaa

DBGET integrated database retrieval system