KEGG   Acaryochloris marina: AM1_1261Help
Entry
AM1_1261          CDS       T00617                                 

Definition
glycerophosphoryl diester phosphodiesterase
Orthology
K01126  
glycerophosphoryl diester phosphodiesterase [EC:3.1.4.46]
Organism
amr  Acaryochloris marina
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:amr00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    AM1_1261
Enzymes [BR:amr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.46  glycerophosphodiester phosphodiesterase
     AM1_1261
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1246176..1246898)
Genome map
AA seq 240 aa AA seqDB search
MVPQITAHRGYSQLAPENTIPAFELAIEHQADFIELDVQETKDHGLVVIHDSHLLRLAGC
DRNLWNLTTSELANLDVGQWFGEAFKQTRIPSLASVMDLAKDRIKLNLELKCHGHEQELV
SQVVELIHQKNWQQNCVVSSLDFDTLRQVRTLDPGLTIGPVIPPSRPEYPDLEVDFYSLH
FTLATSERVKQAHAEGKAIHVWTVNQPADMQRMIEHGVDNIITDQPAALKTEMASKQTKN
NT seq 723 nt NT seq  +upstreamnt  +downstreamnt
atggtgccccaaattacggctcaccgcggctattctcagttggctccggaaaatacgatt
cctgcttttgagctagcgattgagcaccaggctgattttattgaactggatgtccaagag
accaaagatcatgggttggtggtgattcatgatagtcatttgttgcgtcttgcgggttgc
gatcgcaacctctggaacctaactacctctgaactggcaaacctagatgtcggtcagtgg
tttggggaggcgtttaagcagactcgaatcccttccctggcctcagtgatggatttggct
aaggacagaattaagttaaacctggagctgaaatgccatggccatgaacaagaacttgtt
agccaggtggtcgaactaatccaccaaaaaaattggcagcaaaactgtgtggtttcctcc
ctcgactttgataccctgcggcaggtccgaacgctagaccctgggttgacgattggccca
gtcattcccccttctcgacctgagtatcctgatctcgaggtcgatttttattcacttcac
ttcaccctggccacatcagaacgagtcaaacaggcccatgcagaaggaaaagccattcat
gtctggacggtcaatcagcctgctgatatgcagcggatgattgaacatggggtagacaat
atcatcaccgatcaaccggcagcacttaaaacagaaatggcatcaaaacaaaccaaaaac
tga

DBGET integrated database retrieval system