KEGG   Acaryochloris marina: AM1_1261Help
Entry
AM1_1261          CDS       T00617                                 

Definition
glycerophosphoryl diester phosphodiesterase
Orthology
K01126  
glycerophosphoryl diester phosphodiesterase [EC:3.1.4.46]
Organism
amr  Acaryochloris marina
Pathway
Glycerophospholipid metabolism
Class
Metabolism; Lipid metabolism; Glycerophospholipid metabolism [PATH:amr00564]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1246176..1246898)
Genome map
AA seq 240 aa AA seqDB search
MVPQITAHRGYSQLAPENTIPAFELAIEHQADFIELDVQETKDHGLVVIHDSHLLRLAGC
DRNLWNLTTSELANLDVGQWFGEAFKQTRIPSLASVMDLAKDRIKLNLELKCHGHEQELV
SQVVELIHQKNWQQNCVVSSLDFDTLRQVRTLDPGLTIGPVIPPSRPEYPDLEVDFYSLH
FTLATSERVKQAHAEGKAIHVWTVNQPADMQRMIEHGVDNIITDQPAALKTEMASKQTKN
NT seq 723 nt NT seq  +upstreamnt  +downstreamnt
atggtgccccaaattacggctcaccgcggctattctcagttggctccggaaaatacgatt
cctgcttttgagctagcgattgagcaccaggctgattttattgaactggatgtccaagag
accaaagatcatgggttggtggtgattcatgatagtcatttgttgcgtcttgcgggttgc
gatcgcaacctctggaacctaactacctctgaactggcaaacctagatgtcggtcagtgg
tttggggaggcgtttaagcagactcgaatcccttccctggcctcagtgatggatttggct
aaggacagaattaagttaaacctggagctgaaatgccatggccatgaacaagaacttgtt
agccaggtggtcgaactaatccaccaaaaaaattggcagcaaaactgtgtggtttcctcc
ctcgactttgataccctgcggcaggtccgaacgctagaccctgggttgacgattggccca
gtcattcccccttctcgacctgagtatcctgatctcgaggtcgatttttattcacttcac
ttcaccctggccacatcagaacgagtcaaacaggcccatgcagaaggaaaagccattcat
gtctggacggtcaatcagcctgctgatatgcagcggatgattgaacatggggtagacaat
atcatcaccgatcaaccggcagcacttaaaacagaaatggcatcaaaacaaaccaaaaac
tga

DBGET integrated database retrieval system